SecReT4
Protein ID: 291288986
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_074
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]48804..49289 [-]
ProductX polypeptide
Component typeOrf169_F
UniProt IDD4HQJ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 161 a.a.     [Download]
>gi|291288986|ref|YP_003517489.1| X polypeptide [Klebsiella pneumoniae]
MKGVAFGIILSLIPLSSMAADCFDMAGRDYKIDPDLLRAISWQESRFKIDAIGRNPVTGYGSGLMQIDSQ
HFNELSRYGIKPDHLLSDACLNIYTGAYYLAQAFKKWGVSWDAVGAYNAGFKKTPRQAARRYEYAKKIHY
YYTAIKASKRTSSKDQKIAMN
 
Nucleotide Sequence: 486 bp     [Download]
>gi|291288912|ref|NC_013950.1|:c49289-48804 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAAGGGAGTAGCGTTTGGTATCATCCTGTCTTTAATACCATTGTCATCAATGGCAGCAGACTGCTTTG
ATATGGCTGGCAGGGATTACAAAATTGATCCGGATCTCCTGCGTGCTATATCATGGCAAGAATCACGATT
TAAAATTGATGCGATTGGGCGTAATCCTGTTACGGGTTATGGATCAGGCTTGATGCAAATTGACTCGCAG
CATTTCAACGAACTGTCGCGATATGGAATAAAACCGGATCATCTTCTTAGCGATGCTTGTCTTAACATCT
ACACCGGAGCCTATTATCTGGCTCAGGCGTTTAAAAAGTGGGGCGTTTCGTGGGATGCAGTCGGGGCATA
CAATGCAGGCTTCAAAAAGACCCCGCGCCAGGCAGCAAGACGTTACGAGTATGCGAAGAAGATCCATTAC
TACTACACGGCTATCAAAGCAAGCAAACGAACTTCTTCTAAAGATCAGAAAATCGCCATGAACTAA
 Primer design