SecReT4
Protein ID: 291288987
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_075
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]49721..50113 [+]
ProductIncF plasmid conjugative transfer mating signal transduction protein
Component typeTraM_F
UniProt IDD4HQJ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 3.2e-56, Aligned region: 1..127
Protein Sequence: 130 a.a.     [Download]
>gi|291288987|ref|YP_003517490.1| IncF plasmid conjugative transfer mating signal transduction protein [Klebsiella pneumoniae]
MAKIQVYVNDKVAEKINAIAVQRRAEGAKEKDISYSSIASMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESMVKTQFTVNKVLGIECLSPHVHGNPRWEWSGLIENIRDDVNAVIEQFFPKVDDTDND
 
Nucleotide Sequence: 393 bp     [Download]
>gi|291288912|ref|NC_013950.1|:49721-50113 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGGCTAAGATCCAAGTTTATGTAAATGACAAAGTTGCAGAGAAAATTAATGCGATAGCAGTTCAGCGTC
GTGCTGAAGGTGCGAAAGAGAAAGATATTAGCTATTCAAGTATTGCATCGATGTTGCTTGAGCTTGGTTT
GCGTGTCTACGAAGCCCAGATGGAACGCAAAGAATCCGGGTTTAATCAGATGGCATTCAATAGAGCGCTG
CTTGAAAGCATGGTTAAAACACAGTTTACTGTGAATAAGGTGCTGGGGATTGAATGTTTGAGTCCTCATG
TTCATGGTAACCCAAGATGGGAATGGTCAGGGTTAATAGAAAACATCCGGGATGACGTTAATGCTGTGAT
AGAGCAATTCTTTCCAAAAGTGGATGACACTGACAATGATTAG
 Primer design