SecReT4
Protein ID: 291288988
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_076
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]51399..51767 [+]
ProductTraA
Component typeTraA_F
UniProt IDD4HQJ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 2.2e-33, Aligned region: 1..120
Protein Sequence: 122 a.a.     [Download]
>gi|291288988|ref|YP_003517491.1| TraA [Klebsiella pneumoniae]
MNAVLSVQGSAVSEKTKPSFMSRVFNKKKALKVAKVALPVAAVAAFFPDAAMATTTATDLMKSGDATVKG
TFGKQSSVVKWVVLAEVVAGGIMYMMTKNVKFLFGFAIISTFITIGMSVAGY
 
Nucleotide Sequence: 369 bp     [Download]
>gi|291288912|ref|NC_013950.1|:51399-51767 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAATGCTGTATTAAGTGTTCAGGGCTCTGCTGTCTCTGAAAAAACCAAACCGTCTTTTATGTCCCGCG
TTTTCAATAAAAAGAAAGCCCTGAAAGTCGCTAAAGTTGCGCTGCCGGTTGCTGCTGTGGCGGCGTTCTT
CCCGGATGCTGCGATGGCCACCACCACGGCAACCGACCTGATGAAGTCCGGGGATGCGACCGTTAAAGGC
ACGTTTGGTAAGCAGTCCAGCGTCGTCAAATGGGTGGTTCTGGCGGAAGTTGTCGCCGGCGGCATCATGT
ACATGATGACCAAAAACGTGAAGTTCCTGTTTGGCTTCGCGATTATTTCCACCTTTATCACCATCGGTAT
GTCGGTCGCCGGTTACTGA
 Primer design