SecReT4
Protein ID: 291288989
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_077
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]51709..52086 [+]
ProductTraL
Component typeTraL_F
UniProt IDD4HQK0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.4e-38, Aligned region: 32..125
Protein Sequence: 125 a.a.     [Download]
>gi|291288989|ref|YP_003517492.1| TraL [Klebsiella pneumoniae]
MASRLFPPLSPSVCRSPVTDRKHVMTGDELKRYRFPETLTNQSRWFGLYLDELIPAVICLGWGFWTSKFI
FGIASAVLVFWGIKKLKKGRGSSWLRDLIYWYLPTSLLKGFFHDVPDSCFRQWIK
 
Nucleotide Sequence: 378 bp     [Download]
>gi|291288912|ref|NC_013950.1|:51709-52086 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
TTGGCTTCGCGATTATTTCCACCTTTATCACCATCGGTATGTCGGTCGCCGGTTACTGACAGGAAGCACG
TGATGACGGGAGACGAATTAAAGCGATACCGTTTCCCGGAAACACTGACTAACCAGTCCCGCTGGTTTGG
CTTATATCTCGATGAACTTATCCCGGCCGTGATTTGTCTCGGCTGGGGTTTCTGGACCAGCAAGTTCATA
TTTGGCATAGCTTCAGCGGTACTGGTTTTCTGGGGTATCAAGAAACTGAAAAAAGGGCGGGGCAGTTCCT
GGCTACGCGACCTGATTTACTGGTATCTGCCAACCTCCCTTCTTAAAGGTTTCTTTCATGATGTTCCGGA
CTCCTGTTTCCGGCAGTGGATTAAATAA
 Primer design