SecReT4
Protein ID: 291288990
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_078
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]52106..52672 [+]
ProductTraE
Component typeTraE_F
UniProt IDD4HQK1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.6e-75, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|291288990|ref|YP_003517493.1| TraE [Klebsiella pneumoniae]
MEHGARQNTTRVIAVGFISLGTLLTLSLATNIIQGINNYRLQTEQKVAVTPMLFRAPFAVSQNQADASYI
EQLGLSFVALRLNVTPETVDAQHQQLLRYVLPASQNSLKVQLAEDAKRIKDNNVNSTFYMTSMRAWPAEN
RVDIRGELKTWIGDSKPYSEIKSYVIQFSRVDGVSWLARFGEINNEKN
 
Nucleotide Sequence: 567 bp     [Download]
>gi|291288912|ref|NC_013950.1|:52106-52672 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGGAACATGGTGCCAGACAAAATACCACCCGCGTTATCGCTGTGGGATTTATCAGTCTGGGGACACTCC
TGACCCTCAGTCTTGCGACCAATATTATCCAGGGCATAAATAATTACCGTCTGCAGACGGAACAGAAAGT
GGCGGTGACACCGATGTTATTCCGTGCACCCTTTGCGGTGTCTCAGAACCAGGCTGACGCCTCTTATATT
GAGCAGCTGGGCCTGTCCTTTGTTGCCCTGCGTCTGAATGTCACGCCGGAAACGGTTGATGCCCAGCATC
AGCAGCTACTCCGGTATGTATTACCCGCCTCGCAGAACAGCCTCAAGGTCCAGCTGGCTGAAGATGCGAA
ACGCATTAAAGACAATAACGTTAATTCCACCTTTTATATGACGTCGATGCGTGCCTGGCCGGCAGAGAAC
CGCGTGGATATCCGGGGTGAGCTGAAAACGTGGATTGGGGATTCCAAACCCTACAGTGAAATTAAAAGCT
ATGTAATTCAGTTCAGTCGTGTCGATGGTGTCAGCTGGCTGGCGCGTTTTGGAGAAATAAATAATGAAAA
AAATTAA
 Primer design