SecReT4
Protein ID: 291288991
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_079
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]52659..53399 [+]
ProductTraK
Component typeTraK_F
UniProt IDD4HQK2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.9e-72, Aligned region: 11..237
Protein Sequence: 246 a.a.     [Download]
>gi|291288991|ref|YP_003517494.1| TraK [Klebsiella pneumoniae]
MKKINPLFISGCLLLAAPAMSATLSGTLAPTVVPLTNGGQANIAVSNTDPNLFTVPGDRITAINSLDGGL
TNQEQTDSGGAILATVSKKPFTFIVETERGLNFSIRAVPRAGSGRTIQLVSELAGTPGPAKAWEESNPYE
SLLVSLNRAVRQGSVPDEYQSVPVTSEVLQVPAGLRATADRVWVGHHLKVVRYSLDNVSLSPRMVRESDF
WQPGTRAVMFSTPAGLLTAGGRMQIWVTTSDEGVKR
 
Nucleotide Sequence: 741 bp     [Download]
>gi|291288912|ref|NC_013950.1|:52659-53399 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAAAAAAATTAACCCGTTATTTATTTCAGGCTGTCTGCTGTTGGCCGCCCCCGCGATGTCCGCGACCC
TCAGCGGTACGCTGGCGCCGACAGTGGTCCCCCTGACCAATGGTGGTCAGGCAAATATTGCCGTGAGTAA
CACCGACCCGAATCTGTTCACAGTACCTGGAGATCGCATCACGGCGATAAACAGCCTGGACGGTGGCCTG
ACAAACCAGGAGCAGACCGACAGCGGCGGTGCCATTCTGGCGACCGTCAGTAAAAAACCATTCACCTTCA
TTGTGGAAACCGAACGCGGGCTGAACTTCTCCATTCGTGCCGTGCCCCGTGCGGGCTCAGGCCGGACAAT
TCAGCTGGTCAGCGAGCTGGCGGGTACCCCCGGTCCGGCAAAAGCCTGGGAAGAGTCGAACCCCTATGAA
TCGTTACTGGTTTCGCTTAATCGCGCCGTGCGCCAGGGCAGCGTACCCGATGAGTATCAGTCTGTCCCCG
TCACCTCTGAAGTGCTGCAGGTGCCGGCTGGTCTGCGCGCCACTGCCGACAGGGTCTGGGTCGGCCACCA
CCTGAAAGTCGTCCGTTACAGTCTGGATAACGTCTCCCTGTCGCCCCGTATGGTGCGTGAAAGCGATTTC
TGGCAGCCCGGAACACGTGCCGTCATGTTCAGTACCCCGGCGGGCCTGCTGACTGCCGGTGGTCGCATGC
AGATCTGGGTCACGACGTCAGATGAAGGAGTGAAGCGCTGA
 Primer design