SecReT4
Protein ID: 291288992
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_080
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]53399..54823 [+]
ProductTraB
Component typeTraB_F
UniProt IDD4HQK3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-38, Aligned region: 209..405
Protein Sequence: 474 a.a.     [Download]
>gi|291288992|ref|YP_003517495.1| TraB [Klebsiella pneumoniae]
MANFNTLIKRKQYIWLGLILAGGAAAVGGGLYLSDLNMSSDEEAPAQGEPAPDMTGVVDSSFNSKVEQHA
TTEMQATAADLNKRFDSLQGEVDLLSKARTADQIRIDKLSSDNEAMQTQLKALGVKPAVSGGEPAPTPPS
PPPGPEGEPQPASYPPQTGAAVPPPTAFYPGNGMTPPPQVSYQSVPVPNQIQRKTFSYDKGKKTKSLPYI
PSGSFAKSMLIEGADANASVTGNESTVPMQLRITGRVEMPNSKTYDLTGCFVGLEAWGDVSSERAIVRTR
NISCIKGDKTIDQPINGHVSFMGKNGVKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLGATAS
VGAGDVLKMGVGGGASKAAQTLSEYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTIEELEAEKNGQQQ
AQNQEAEPAPQADAHHQSGGGMNGFNTDEMLKKLGKLDPREFSPGAAPQGENNG
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|291288912|ref|NC_013950.1|:53399-54823 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGGCCAACTTCAACACGCTGATCAAACGTAAGCAATATATCTGGCTGGGACTCATTCTGGCGGGCGGCG
CGGCAGCAGTCGGAGGCGGGCTGTATCTGTCAGATCTGAACATGAGCTCTGATGAGGAAGCCCCGGCTCA
GGGCGAACCCGCACCGGATATGACCGGGGTGGTCGACAGCAGCTTCAACAGTAAGGTGGAGCAGCACGCG
ACAACAGAAATGCAGGCGACTGCCGCTGATCTCAACAAGCGTTTTGACTCCCTGCAGGGGGAAGTGGACC
TGCTGAGTAAGGCGCGAACCGCTGACCAGATACGTATCGACAAGCTCAGCAGTGACAATGAAGCCATGCA
GACTCAGCTGAAGGCGCTGGGCGTGAAACCGGCTGTCTCTGGTGGCGAGCCCGCGCCGACTCCTCCGTCA
CCGCCACCCGGTCCGGAAGGGGAGCCGCAGCCAGCCAGTTATCCGCCGCAAACCGGCGCCGCGGTACCGC
CTCCGACGGCATTCTATCCGGGGAATGGTATGACACCGCCGCCGCAGGTCAGCTACCAGTCTGTACCGGT
ACCAAACCAGATACAGCGTAAAACGTTCAGTTACGACAAAGGAAAAAAAACGAAGTCATTGCCGTACATT
CCGTCGGGGAGCTTTGCAAAAAGTATGCTTATCGAGGGGGCAGATGCCAACGCGTCTGTTACCGGGAATG
AATCAACTGTACCGATGCAGTTGCGTATCACTGGTCGCGTGGAAATGCCAAACAGCAAAACCTACGACCT
GACAGGGTGTTTTGTGGGCCTTGAAGCCTGGGGCGATGTCTCCAGCGAACGCGCCATTGTCCGTACCCGC
AATATCAGCTGTATCAAAGGTGATAAAACCATCGATCAGCCCATTAACGGCCACGTTTCCTTTATGGGGA
AAAACGGGGTTAAGGGAGAGGTGGTGATGCGTAACGGAAAAATCCTCGGCTGGGCATGGGGGGCCGGTTT
TGTTGACGGGATTGGTCAGGGCATGGAACGGGCTTCACAGCCGGCTGTTGGCCTGGGGGCAACCGCATCT
GTTGGCGCCGGTGACGTTCTGAAAATGGGGGTCGGCGGTGGTGCATCTAAAGCTGCGCAGACGCTGAGCG
AGTACTACATCAAAAGGGCCGAGCAGTATCACCCGGTCATTCCGATTGGTGCCGGCAACGAAGTGACCGT
CGTGTTCCAGGATGGATTCCAGCTGAAAACGATTGAAGAGCTGGAAGCGGAAAAGAACGGGCAACAGCAG
GCTCAGAATCAGGAGGCGGAGCCGGCACCGCAGGCTGATGCCCATCATCAGTCAGGCGGCGGTATGAACG
GATTCAATACTGACGAGATGCTGAAGAAGCTGGGCAAACTTGATCCGCGGGAGTTCTCTCCGGGCGCAGC
GCCGCAGGGGGAAAATAATGGCTAA
 Primer design