SecReT4
Protein ID: 291288993
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_081
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]54937..55521 [+]
ProductF pilus assembly protein
Component typeTraV_F
UniProt IDD4HQK4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 9.2e-40, Aligned region: 23..188
Protein Sequence: 194 a.a.     [Download]
>gi|291288993|ref|YP_003517496.1| F pilus assembly protein [Klebsiella pneumoniae]
MKELMLLIPLGGALLLTGCAGTETEFQCNATTSDTCMTMEQANEKAKLKEERSDAKPAAAGLPQLAEGNF
RTTSVNSYPLPPQSNLTQARVAAEKDRARAVYLNNPTAKNEATYFETEKRLQSLPVVKMSLPVVASTFTS
PSTPPGNYPRPLRKGEETTSLWIAPYVDADDVYHQPATVLFVVTPSAWGQPRLN
 
Nucleotide Sequence: 585 bp     [Download]
>gi|291288912|ref|NC_013950.1|:54937-55521 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAAGGAATTAATGCTGTTAATTCCTCTGGGCGGCGCTTTGCTCTTAACCGGGTGCGCGGGCACAGAGA
CTGAATTTCAATGTAATGCCACGACGTCGGATACCTGTATGACGATGGAGCAGGCAAATGAAAAAGCGAA
GCTGAAAGAGGAACGCAGTGATGCAAAGCCGGCTGCGGCCGGGTTGCCACAACTGGCTGAGGGTAATTTC
AGAACCACGTCAGTGAATTCGTACCCGTTGCCGCCACAGTCCAACCTGACCCAGGCCAGAGTGGCCGCGG
AGAAAGATCGAGCACGTGCAGTGTACCTAAATAATCCAACGGCAAAGAATGAGGCAACATATTTCGAAAC
CGAGAAAAGGCTCCAGTCTTTGCCGGTAGTGAAAATGTCTTTACCAGTAGTGGCGTCAACGTTTACGTCA
CCGTCAACACCGCCAGGTAATTATCCCCGGCCATTAAGAAAAGGGGAGGAGACAACGTCATTGTGGATAG
CGCCGTATGTGGATGCAGATGATGTATATCACCAGCCAGCAACGGTTCTTTTTGTCGTGACACCATCGGC
GTGGGGACAACCTCGCCTTAATTGA
 Primer design