SecReT4
Protein ID: 291288997
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_085
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]58016..60655 [+]
ProductTraC
Component typeTraC_F
UniProt IDD4HQK8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.5e-60, Aligned region: 38..278
AAA_10 [PF12846], Evalue: 2e-42, Aligned region: 481..777
Protein Sequence: 879 a.a.     [Download]
>gi|291288997|ref|YP_003517500.1| TraC [Klebsiella pneumoniae]
MSNNIIDAVTQAVNSLVSALKLPDESAKANDTLGSMNFPQFSRILPYKDYDSATGLFINNKTIGFMFEAR
PLPGADKSIVATLEHLLRSKLPRGVPVSFHLVSSKLVGNDIDYGLREFRWSGKQAKKFNAITQAYYLRAA
ETKFPLPPALDLPLTLRNYRVYISCCVPRKKNSTTQIVEMENQIKILRASLGGAYIPTRILDAAGLVELM
RELINPDPHEMYRVPYKLDPYQDLNYQCVDDSFDMQVTAGHLKIGRLGRDGKECVTRVTSYHLESDPEMA
FLWTSADNYANLLNPELSISCPFVITLTLMVEDQVKTQNEANMKFMDVEKKSKTSYAKFFPNVIKEMQEW
GDIRQRLATNQTSLVSYFFNITTYTADSTEASLAAEQQVLNSYRKGGFQLIPARYHHLRNFLAMMPFKCG
EGLFKELQAAGVVKRAETFQVANLLPIVADSPLAPAGLLAPTYRNQLAFIDLFYEGMNNTNFNMAVCGTS
GAGKTGLIQPLIRSVLDSGGFAWVFDMGDGYKSLCENMGGVYLDGDTLKFNPFANVLDDAHFDMSAERIR
DQMSVMASPNGNLDEVHEGLLLQAVQAAWLSKRNHARVDDVVQFLQDAKDSDEYADSPTIRGRLDEMIIL
LDQYTVNGIYGDYFNSDTPTLHEDARMVVLELGGLESRPSLLIAVMFSLIIYIENRMYQSPRGLKKLNVI
DEGWKLLDFKNEKVGQFIEKGYRTARRHTGAYITITQNIVDFDSPTASSAARAAWGNSSYKAILKQSAKE
FAKYNQLYPDQFSKLEKDMINGFGSAKEQWFSSFMLQVEANCSWHRLFVDPLSRAMYSSKGPDFEYMKAR
REEGVDIHDAVYGLACRNFKDEMAELESRIPVNDMEDKQ
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|291288912|ref|NC_013950.1|:58016-60655 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAGTAATAACATCATCGATGCCGTCACCCAGGCAGTGAATTCACTGGTATCAGCACTGAAGCTGCCCG
ACGAATCCGCGAAAGCCAATGACACGCTGGGCAGCATGAATTTCCCCCAGTTCAGCCGTATTTTGCCCTA
TAAGGATTATGATTCCGCGACCGGGCTGTTTATTAATAACAAAACCATCGGTTTTATGTTTGAGGCGCGT
CCTTTACCCGGTGCGGATAAAAGTATCGTCGCCACACTGGAGCATTTACTGCGCAGCAAACTTCCCCGGG
GCGTCCCGGTCAGTTTTCATCTGGTCTCCAGCAAACTGGTCGGCAATGATATCGACTACGGTCTGCGTGA
ATTCCGCTGGAGCGGTAAACAGGCTAAGAAGTTTAACGCCATCACCCAGGCCTACTATCTCCGGGCAGCG
GAGACGAAGTTCCCCCTGCCTCCTGCACTGGATTTACCCCTGACGCTGCGTAACTACCGCGTGTACATCT
CCTGCTGCGTGCCCCGGAAGAAAAACTCCACCACGCAAATTGTGGAGATGGAGAACCAGATTAAAATCCT
GCGGGCGTCACTGGGCGGTGCCTATATTCCGACGCGTATCCTTGATGCTGCCGGGCTGGTCGAACTGATG
CGCGAGCTTATAAACCCGGACCCGCACGAGATGTACCGCGTACCGTATAAGCTGGACCCCTATCAGGATC
TGAACTATCAGTGTGTCGATGACAGCTTTGATATGCAGGTCACCGCCGGTCATCTGAAAATTGGCCGCCT
GGGGCGTGACGGGAAAGAGTGCGTAACCCGGGTGACGAGCTACCATCTGGAGAGTGATCCGGAAATGGCC
TTCCTCTGGACCTCCGCGGATAACTACGCCAACCTGCTTAACCCGGAGCTCTCCATTTCCTGCCCCTTTG
TCATTACGCTGACGCTGATGGTGGAGGACCAGGTGAAGACCCAGAATGAAGCCAACATGAAATTCATGGA
CGTGGAGAAGAAAAGCAAAACCTCCTACGCGAAGTTTTTTCCGAACGTGATAAAGGAAATGCAGGAGTGG
GGCGATATCCGCCAGCGACTGGCGACCAACCAGACCTCCCTGGTGTCCTACTTCTTTAATATCACCACGT
ACACCGCAGACAGCACAGAGGCCTCTCTCGCCGCTGAACAGCAGGTGCTCAACAGCTACCGTAAAGGCGG
TTTCCAGCTGATCCCGGCCCGCTACCATCACCTGCGTAACTTTCTGGCCATGATGCCGTTCAAGTGTGGT
GAGGGCCTGTTTAAAGAGCTGCAGGCGGCAGGCGTGGTGAAGCGGGCGGAGACGTTCCAGGTGGCTAACC
TCCTGCCGATCGTCGCTGACAGCCCGCTGGCGCCGGCGGGACTCCTGGCGCCCACCTACCGAAATCAGCT
GGCGTTCATCGACCTGTTCTACGAGGGAATGAACAATACCAATTTCAACATGGCAGTCTGCGGGACGTCC
GGGGCGGGTAAAACCGGTCTGATTCAGCCCCTCATTCGCAGTGTGCTCGACTCCGGCGGGTTTGCCTGGG
TGTTCGACATGGGCGATGGCTATAAGTCCCTGTGTGAAAACATGGGGGGCGTATACCTCGATGGCGATAC
CCTCAAGTTTAACCCGTTCGCCAACGTGCTGGATGATGCTCACTTCGACATGTCAGCAGAACGTATACGC
GATCAGATGTCTGTCATGGCCAGTCCGAACGGCAACCTCGATGAAGTCCATGAAGGCCTGCTTCTGCAGG
CAGTGCAGGCGGCCTGGTTAAGCAAGCGTAATCATGCACGCGTTGATGACGTAGTGCAGTTTTTACAGGA
CGCGAAGGACAGCGATGAATATGCTGATTCCCCAACAATCCGGGGCCGTCTGGACGAGATGATAATCCTG
CTCGATCAGTACACGGTAAATGGGATCTACGGGGACTATTTCAACTCAGATACACCAACACTCCACGAAG
ATGCCCGGATGGTGGTACTGGAGCTCGGTGGCCTGGAGTCGCGGCCATCTCTGCTTATCGCTGTGATGTT
CTCATTGATTATTTACATCGAGAACAGGATGTATCAGTCACCGCGTGGCCTGAAAAAACTGAACGTCATC
GATGAAGGCTGGAAGCTCCTTGATTTCAAAAATGAAAAAGTGGGTCAGTTCATCGAGAAAGGCTACCGTA
CCGCGCGTCGACATACCGGCGCATACATCACCATCACGCAAAATATCGTGGACTTCGACTCCCCGACCGC
ATCGAGCGCTGCACGCGCTGCCTGGGGGAACTCGTCATACAAGGCCATTCTGAAACAGTCAGCGAAGGAA
TTTGCCAAGTATAACCAGCTGTACCCGGATCAGTTCAGCAAGCTGGAGAAAGACATGATTAACGGCTTCG
GTTCGGCCAAAGAGCAGTGGTTCAGCTCTTTTATGCTGCAGGTGGAAGCGAACTGCTCCTGGCACCGCCT
GTTCGTCGACCCGCTCAGCCGGGCGATGTACTCCTCAAAAGGCCCGGATTTTGAGTACATGAAAGCGCGC
CGGGAAGAGGGGGTCGATATCCACGATGCGGTGTACGGCCTCGCGTGTCGCAACTTTAAAGACGAAATGG
CAGAGCTTGAATCCCGAATACCGGTGAATGACATGGAGGATAAACAGTGA
 Primer design