SecReT4
Protein ID: 291288999
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_087
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]61044..61670 [+]
ProductTraW
Component typeTraW_F
UniProt IDD4HQL0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 3.5e-07, Aligned region: 7..32
Protein Sequence: 208 a.a.     [Download]
>gi|291288999|ref|YP_003517502.1| TraW [Klebsiella pneumoniae]
MIRLKDCLLAACLVSPLTQAADLGTWGDLWPVREQDMLQLITQRLQSLQSSGQWDQTMDAFKQRVIENSQ
RPAPVEGIKRAEKYEQRWFDPSIRLTEDLKDNEGRVFARKGDVVNPLKTVPFVQTLYFINGDDADQLAWM
KRQVPETLMSKIILVRGSIPDTSAALDSRIYFDQNGVLSKRFGLTAVPARITPAPSGERLNIEVFPVR
 
Nucleotide Sequence: 627 bp     [Download]
>gi|291288912|ref|NC_013950.1|:61044-61670 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGATACGACTGAAAGACTGTCTGCTCGCCGCCTGCCTGGTATCGCCGCTGACTCAGGCGGCTGATCTCG
GTACCTGGGGGGATTTATGGCCCGTCCGGGAGCAGGACATGCTGCAGCTCATCACGCAGCGTCTGCAGTC
ACTGCAATCCTCTGGCCAGTGGGACCAGACGATGGATGCGTTTAAGCAGCGGGTTATCGAGAACAGTCAG
CGCCCGGCACCGGTGGAGGGCATTAAGCGTGCGGAGAAATACGAGCAGCGCTGGTTTGATCCCAGCATCC
GCCTGACCGAAGACCTGAAGGACAATGAGGGGCGGGTGTTTGCCCGCAAGGGCGATGTGGTGAACCCGCT
TAAAACCGTACCGTTTGTCCAGACCCTGTACTTCATCAATGGAGACGATGCCGACCAGCTGGCCTGGATG
AAGCGTCAGGTGCCGGAAACCCTGATGAGCAAAATTATCCTGGTGCGTGGCAGTATCCCGGACACCTCCG
CAGCGCTGGACAGCCGGATCTATTTCGACCAGAACGGCGTACTGAGCAAGCGATTTGGCCTGACGGCGGT
CCCGGCGCGGATCACGCCGGCGCCCTCCGGTGAACGGCTGAATATTGAGGTGTTTCCCGTCCGTTGA
 Primer design