SecReT4
Protein ID: 291289001
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_089
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]62098..63087 [+]
ProductTraU
Component typeTraU_F
UniProt IDD4HQL2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 7.7e-85, Aligned region: 28..328
Protein Sequence: 329 a.a.     [Download]
>gi|291289001|ref|YP_003517504.1| TraU [Klebsiella pneumoniae]
MRKISFLFILLFFSLVPQVHADPSCEGRFVNPITDVCWRCIFPLSLGSVQVGKGDLPDTSNPGSPLQLCP
APPPIFVRPGLAIGYWEPMAMTDVSRSPGCMVNLGGFSINLGKTGMGTARKDDKQVNGAFYHVHWYKYPL
TYWLNIITSAGCLEGGDMDIAYLSEIDPTWVDSSLTTILNPEAILFANPIAQGACAADAMASAFHMPLDI
LFWCAGSQGSMYPFSGWVSNESSPLQSSLLVSERMAYKLHRQGQIMESIGKDKAVCYEYPSPIIPKERWR
YQMVNMYPDSGQCHPVGRSVMRWEAGKNPPNTRKNYGYLMWRKRNCVFL
 
Nucleotide Sequence: 990 bp     [Download]
>gi|291288912|ref|NC_013950.1|:62098-63087 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAGAAAAATATCATTTTTGTTTATCCTCCTGTTTTTTTCGTTAGTCCCTCAGGTACATGCAGATCCGT
CGTGTGAAGGTCGATTCGTCAACCCGATCACCGATGTGTGCTGGCGCTGCATATTTCCTTTATCACTCGG
CAGCGTGCAGGTTGGTAAAGGCGATCTGCCTGATACCAGCAATCCGGGTAGTCCCCTGCAGCTGTGTCCG
GCGCCGCCACCGATTTTTGTTCGCCCCGGCCTGGCCATCGGGTACTGGGAGCCGATGGCCATGACGGACG
TCAGCCGTTCGCCTGGCTGTATGGTCAATCTGGGGGGCTTCAGTATCAATCTCGGCAAGACCGGTATGGG
GACCGCGAGAAAGGACGACAAGCAGGTGAACGGCGCTTTTTATCACGTTCACTGGTACAAGTACCCGCTG
ACCTACTGGCTGAACATCATCACCTCCGCAGGCTGTCTGGAAGGCGGAGACATGGATATAGCCTATCTGT
CCGAGATTGACCCGACCTGGGTGGACAGCAGCCTCACCACTATTCTGAATCCGGAAGCCATCCTGTTTGC
CAACCCCATCGCACAGGGGGCGTGCGCGGCTGACGCTATGGCCAGCGCGTTTCATATGCCACTCGATATT
CTGTTCTGGTGTGCCGGCTCTCAGGGTTCGATGTACCCGTTTAGCGGCTGGGTAAGCAACGAGTCCAGTC
CGCTGCAGTCCTCGTTACTTGTCAGCGAGCGCATGGCGTACAAGCTTCACCGGCAGGGACAAATTATGGA
GAGCATCGGGAAGGACAAGGCGGTCTGCTATGAGTATCCGTCCCCGATCATCCCCAAAGAGCGCTGGCGC
TATCAGATGGTGAACATGTACCCGGACAGCGGCCAATGCCATCCCGTGGGGCGCAGCGTGATGCGCTGGG
AGGCCGGTAAAAATCCACCCAACACCCGTAAGAACTATGGCTATCTGATGTGGCGTAAACGCAATTGTGT
CTTTCTCTGA
 Primer design