SecReT4
Protein ID: 291289002
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_090
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]63100..63738 [+]
ProductTrbC
Component typeTrbC_F
UniProt IDD4HQL3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 8.1e-29, Aligned region: 90..188
Protein Sequence: 212 a.a.     [Download]
>gi|291289002|ref|YP_003517505.1| TrbC [Klebsiella pneumoniae]
MKLMNLFMVMLLLTGRAVLAETSSVTDREWLKQQETLSEQLRQHPDKQLQQELEAQINRNPLPKSDRQFI
DNLVSQQKAANQEKPAEGALYFVSFSIPEEGLKRMLHETRQYGIPATLRGLVNNDMKTTTDAVLQLVKDG
VTDGVQIDPTLYTQYSIRSVPSLVVRCQAGYDVVRGNIHVKQALEKVAQTGDCAQVARQILDAPSNAAGS
QP
 
Nucleotide Sequence: 639 bp     [Download]
>gi|291288912|ref|NC_013950.1|:63100-63738 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAAATTAATGAATCTGTTTATGGTCATGCTTTTGCTGACCGGACGAGCGGTGTTGGCTGAAACCTCCT
CTGTTACAGACAGAGAATGGCTGAAGCAGCAGGAGACCCTCAGCGAACAGCTGCGCCAGCATCCGGATAA
ACAGCTGCAGCAGGAGCTTGAGGCGCAAATCAACCGTAATCCTCTGCCCAAATCAGACCGCCAGTTTATC
GATAATCTGGTCAGCCAGCAGAAAGCGGCGAATCAGGAAAAGCCAGCAGAAGGGGCGCTGTACTTTGTCT
CCTTCTCGATACCTGAAGAGGGGCTGAAGCGGATGCTGCACGAAACCCGGCAGTACGGCATTCCGGCGAC
ACTGCGTGGGCTCGTCAATAACGACATGAAGACCACCACTGACGCGGTGCTGCAGCTGGTGAAGGATGGC
GTGACCGACGGCGTGCAGATCGACCCGACACTGTACACGCAGTACAGCATCCGGAGTGTGCCGTCTCTGG
TGGTACGGTGTCAGGCCGGATATGACGTGGTACGCGGTAACATTCACGTCAAACAGGCGCTGGAGAAAGT
GGCACAAACCGGTGACTGCGCACAGGTGGCCCGGCAAATACTTGATGCGCCCTCGAATGCCGCCGGGAGC
CAGCCATGA
 Primer design