SecReT4
Protein ID: 291289003
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_091
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]63797..65752 [+]
ProductTraN
Component typeTraN_F
UniProt IDD4HQL4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.1e-71, Aligned region: 354..600
Protein Sequence: 651 a.a.     [Download]
>gi|291289003|ref|YP_003517506.1| TraN [Klebsiella pneumoniae]
MKTVISVLTAHFFVLSAFIWLASPACADSGSDYKAGSDFAKQVQGNGLNSLKNFSGEQNLPGYTDSPDQT
KYYGGVTASGDSSLKSDSALEFSQGDTGKAITESFTNRPPDQISQDAPFIQAAKDTESRADSIVGDTGQS
CTAQVVNRSEFTNHTCERDLQVENFCTREATLKDNATTQKVNRTYQQVVTLNYARSTRQWSGNLTIPTNG
RLLNASVDGEPLVIPWIEECDSEGKVRDSCKSAVSESLTLFERTFPIDVINWPRSESMCSGGQNTHCTKY
TYDGKGKIHQSFGVDKAVTAGQNFSVSKTSRTVSSASQKPVQVTVTLVMEETETVYAPEVVWVESCPFSK
DEGKKTGEECISPGGTRTITLGGRDYSFTEACWKYKDTWLTQPADNGSCESLMKNTACTLSSRQCAFSSE
EGTCLHEYATYSCETRTSGKQMICGGDVFCLDGECDKATSGKSNDFGQAVSELAALAAAGKDVAALNGVD
VRAFTGKAKFCKKFAAGFSNCCKDSGWGQDVGLARCSSEEKALAKAKKDKLTVSIGEFCSKKVLGICLEK
KRSYCQFDSKLAQIVQQQGRNGQLHIGFGGASSPDCRGITVAELQGIDFNKLDFTNFMDDLMKNQKIPEN
DVLTNKTRERIKEIMSQQSAQ
 
Nucleotide Sequence: 1956 bp     [Download]
>gi|291288912|ref|NC_013950.1|:63797-65752 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAAGACGGTTATTTCCGTGCTGACTGCGCATTTTTTTGTCCTGAGCGCCTTTATCTGGCTGGCATCCC
CAGCCTGTGCTGACAGTGGAAGCGACTATAAAGCTGGTTCGGATTTTGCGAAACAGGTGCAGGGCAATGG
TCTGAACTCACTGAAAAATTTCAGTGGTGAGCAAAACCTGCCGGGGTATACCGACAGCCCTGATCAGACA
AAATACTATGGCGGCGTCACTGCCAGCGGAGACAGCTCTCTGAAAAGCGATTCAGCCCTGGAGTTCAGCC
AGGGAGATACCGGCAAAGCGATTACGGAGTCGTTCACGAACCGGCCACCGGATCAGATATCTCAGGATGC
GCCGTTTATTCAGGCCGCAAAGGATACAGAATCCCGTGCCGACAGCATTGTCGGCGATACCGGACAGTCC
TGTACCGCCCAGGTTGTGAACCGCAGTGAGTTCACAAACCATACCTGCGAACGTGATCTGCAGGTGGAAA
ATTTTTGCACACGGGAAGCGACCCTGAAGGATAACGCCACCACACAGAAAGTTAACCGAACCTATCAGCA
GGTGGTGACGCTGAATTATGCCCGGAGTACCCGGCAATGGAGTGGCAACCTGACGATCCCGACCAACGGT
CGTCTGCTGAATGCCTCGGTGGATGGTGAGCCTCTGGTGATCCCCTGGATTGAAGAATGCGATTCCGAAG
GGAAGGTGCGGGATAGCTGCAAGAGTGCAGTGAGTGAAAGCCTGACCCTCTTTGAACGAACGTTCCCCAT
TGATGTGATCAACTGGCCACGTTCAGAATCGATGTGTTCAGGCGGTCAGAACACGCATTGTACGAAATAT
ACCTATGACGGGAAGGGGAAGATTCATCAGTCGTTTGGTGTGGACAAAGCGGTCACTGCTGGGCAGAACT
TTTCAGTAAGCAAAACATCACGGACCGTATCATCGGCCAGCCAGAAACCCGTACAGGTCACGGTCACCCT
GGTGATGGAAGAAACCGAAACCGTCTATGCACCTGAAGTCGTCTGGGTTGAAAGCTGTCCGTTCAGTAAG
GATGAAGGAAAAAAAACGGGCGAGGAATGTATCAGTCCGGGAGGAACGCGAACCATCACCCTCGGAGGCA
GGGATTACTCGTTCACGGAGGCCTGCTGGAAATATAAGGATACCTGGCTCACGCAGCCGGCGGACAACGG
CTCCTGTGAAAGCCTGATGAAAAATACGGCCTGTACTCTGTCATCCCGCCAGTGCGCCTTCTCCAGCGAG
GAAGGCACGTGCCTGCATGAATATGCAACGTATTCCTGCGAAACCAGGACGAGTGGCAAGCAAATGATCT
GCGGCGGTGATGTCTTCTGCCTTGATGGTGAATGTGACAAAGCCACGTCCGGGAAGAGCAACGACTTTGG
GCAGGCGGTGTCTGAGCTGGCGGCACTGGCTGCCGCGGGGAAGGACGTCGCGGCACTGAACGGGGTGGAT
GTCCGGGCATTCACCGGAAAAGCGAAGTTCTGTAAGAAGTTTGCTGCCGGCTTCAGTAACTGCTGCAAAG
ACAGCGGCTGGGGCCAGGATGTGGGGCTGGCACGCTGCAGCAGCGAGGAAAAGGCGCTGGCCAAAGCGAA
AAAAGACAAGCTGACGGTCAGTATAGGGGAATTCTGCTCTAAAAAGGTTCTGGGGATTTGCCTGGAGAAA
AAAAGGAGCTATTGCCAGTTCGACTCAAAACTGGCGCAGATCGTTCAGCAGCAGGGAAGAAACGGTCAGC
TGCATATCGGTTTTGGCGGCGCCAGCAGTCCTGACTGTCGGGGCATTACCGTCGCGGAACTCCAGGGGAT
TGATTTTAACAAGCTGGATTTCACCAACTTTATGGACGACCTGATGAAAAATCAAAAAATACCGGAAAAC
GATGTGCTCACCAATAAGACCAGAGAACGAATTAAGGAAATCATGAGTCAGCAATCCGCGCAATAA
 Primer design