SecReT4
Protein ID: 291289006
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_094
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]66624..67376 [+]
ProductTraF
Component typeTraF_F
UniProt IDD4HQL7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.4e-77, Aligned region: 26..240
Protein Sequence: 250 a.a.     [Download]
>gi|291289006|ref|YP_003517509.1| TraF [Klebsiella pneumoniae]
MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAVPAAPPPQMDILEKLATLQAATKRSLY
EAILYPSSENFVKYFRLQNYWTQQAGLFSMSAKKAMLENPELDYNLQYSHYNGTVKNQLAADYAEQRQAI
STLAQHYGVMFFYRGREAIDGQLVQVIKNFRETYGLSVIPVSVDGVINPMLPDSRTDQGQAEQLGVKFFP
AMMLVNPKSGQVKPLSYGFISQDDLAKQFLYVSSDFKPNF
 
Nucleotide Sequence: 753 bp     [Download]
>gi|291288912|ref|NC_013950.1|:66624-67376 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGCGAACAATACATGCCGCCATGCTGGCGGGGTGCCTTTGCTGCGCCCTGATGCCGGCTTTCGCCAAAG
ACGCGGGCTGGCAGTGGTACAACGAGAAACTGAAGCCCCGTGATGAGGACAGGAAAGCCGTACCAGCGGC
ACCACCGCCGCAAATGGATATTCTGGAGAAACTCGCCACACTCCAGGCGGCCACCAAACGGTCGTTGTAC
GAAGCCATTCTGTATCCATCGTCTGAAAACTTCGTGAAGTATTTCCGGCTGCAGAACTACTGGACGCAGC
AGGCAGGTTTGTTCTCGATGAGTGCGAAGAAAGCCATGCTGGAAAACCCCGAACTCGATTACAACCTGCA
GTACAGCCACTACAACGGCACGGTAAAAAACCAGCTCGCTGCCGACTATGCCGAACAGCGACAGGCTATC
TCCACCCTCGCACAGCACTACGGCGTGATGTTCTTCTACCGGGGCCGGGAAGCGATCGATGGCCAGCTGG
TCCAGGTGATTAAAAATTTTCGCGAAACCTATGGCCTGAGCGTGATACCGGTGTCGGTTGACGGAGTGAT
TAACCCCATGCTTCCCGACAGCCGGACGGACCAGGGCCAGGCAGAGCAGCTTGGCGTGAAGTTCTTCCCC
GCGATGATGCTGGTTAACCCGAAAAGTGGCCAGGTGAAGCCTCTCAGTTACGGCTTTATCAGTCAGGACG
ACCTGGCGAAACAGTTCCTCTATGTCTCCAGCGACTTTAAACCGAATTTCTAA
 Primer design