SecReT4
Protein ID: 291289007
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_095
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]67345..67626 [+]
ProductF pilin synthesis
Component typeTraQ_F
UniProt IDD4HQL8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.2e-34, Aligned region: 15..85
Protein Sequence: 93 a.a.     [Download]
>gi|291289007|ref|YP_003517510.1| F pilin synthesis [Klebsiella pneumoniae]
MSPATLNRISKECVMRNIRFPDLDITGMWVLAVGVFFHLIARLVRKQPELAVQAGEIFGLGMVVFGGYRI
LNALIAEAEKEEKACEKQPDEPR
 
Nucleotide Sequence: 282 bp     [Download]
>gi|291288912|ref|NC_013950.1|:67345-67626 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGTCTCCAGCGACTTTAAACCGAATTTCTAAGGAGTGTGTCATGCGAAATATTCGTTTTCCGGATTTAG
ATATCACCGGGATGTGGGTGCTGGCCGTGGGCGTGTTTTTCCACCTGATAGCCCGGCTTGTCAGAAAACA
GCCTGAGCTGGCCGTCCAGGCCGGGGAAATCTTCGGGCTGGGTATGGTGGTGTTCGGGGGATACCGCATT
CTAAACGCCCTGATTGCTGAAGCCGAAAAAGAGGAGAAAGCCTGTGAAAAACAGCCTGATGAACCTCGCT
AA
 Primer design