SecReT4
Protein ID: 291289010
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_098
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]68610..70001 [+]
ProductTraH
Component typeTraH_F
UniProt IDD4HQM1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.9e-118, Aligned region: 36..385
Protein Sequence: 463 a.a.     [Download]
>gi|291289010|ref|YP_003517513.1| TraH [Klebsiella pneumoniae]
MLCVMEDRMRIKLLSLFCGAALGLSFSAAADVNGDMNNFFNKLGFASNTSQPQVWQGQAAGYASGGSLYA
RTQVKTIQLVSMTLPDINAGCGGIDAYLGSFSFINSEQLQRFGKQIMSNAAGYFFDLALQTTVPEIKTAK
DFLQKMATDMNSMNLSSCQAAQGIVGGLFPRTQVAQQKVCQDIAGESNIFSDWAASRQGCTVGGKMDSVQ
DKASDKDKERVMKNINIMWNALSKNRLFDGNKELKEFVMTLTGTLIFGENSEITPLPARTTDQDLIKAMM
EGGTAKIYHCNDSDKCLKVVADATVTITANKALKNQIRALLSSIQNKAVADEKLTEQEKGFISSTTIPVF
KYLVDPQMLGVSNSLIYQLTDYIGYDILLQYIQELIQQARAMISTGNYPQSTMDMIMENLNQASVQIAAF
QSRVQVQQDALLVVDRQMSYMRQQVSARMMTRYQNNYHFGGNL
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|291288912|ref|NC_013950.1|:68610-70001 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGCTGTGCGTAATGGAGGACAGGATGCGAATTAAACTTCTGTCACTTTTCTGCGGTGCCGCGCTTGGCC
TGTCATTTAGCGCCGCCGCCGACGTGAATGGCGACATGAATAACTTCTTCAATAAGCTCGGGTTTGCGTC
CAATACCAGCCAGCCACAGGTCTGGCAGGGGCAGGCGGCGGGTTATGCCTCTGGCGGTTCGCTGTATGCC
AGAACGCAGGTGAAAACGATCCAGCTGGTCAGCATGACCCTGCCGGATATTAACGCCGGCTGCGGCGGCA
TCGATGCGTACCTGGGGTCGTTCTCCTTTATCAACAGCGAGCAGCTGCAGCGCTTTGGCAAACAAATTAT
GTCCAACGCCGCGGGTTACTTCTTTGACCTTGCCCTGCAGACCACGGTTCCGGAGATCAAAACCGCAAAG
GACTTCCTTCAAAAGATGGCCACTGACATGAACAGCATGAACCTCAGTTCCTGCCAGGCTGCTCAGGGAA
TTGTGGGTGGCCTGTTTCCTCGTACCCAGGTCGCTCAACAAAAGGTCTGCCAGGACATTGCCGGTGAAAG
CAATATCTTTTCGGACTGGGCCGCCTCGCGCCAGGGTTGTACGGTGGGCGGCAAGATGGACAGCGTCCAG
GATAAGGCCAGCGATAAAGACAAAGAACGTGTGATGAAGAACATTAACATCATGTGGAATGCCTTATCGA
AGAACCGGCTCTTTGATGGCAATAAGGAGCTGAAAGAGTTTGTGATGACCCTGACCGGTACGCTGATTTT
TGGTGAGAACAGTGAGATCACCCCGTTGCCGGCACGCACCACTGACCAGGATCTGATTAAAGCCATGATG
GAGGGCGGCACAGCTAAAATCTACCACTGCAATGACTCGGATAAATGTCTCAAGGTCGTTGCTGATGCGA
CCGTAACCATCACCGCCAATAAGGCGCTCAAAAATCAGATTCGCGCTTTGTTGAGCAGTATCCAGAATAA
AGCGGTGGCTGATGAAAAACTGACAGAGCAGGAGAAAGGGTTTATCTCCAGCACCACCATTCCGGTGTTC
AAATACCTGGTCGATCCGCAGATGCTCGGGGTGTCTAACTCACTTATTTACCAGCTGACGGACTATATCG
GCTACGACATCCTGCTGCAGTACATTCAGGAACTTATCCAGCAGGCCCGGGCGATGATCTCAACCGGTAA
TTATCCCCAGTCGACAATGGATATGATCATGGAAAATCTCAACCAGGCGAGTGTGCAGATTGCCGCTTTC
CAGTCCCGTGTTCAGGTCCAGCAGGACGCCTTGCTTGTGGTTGACAGACAAATGAGTTACATGCGCCAGC
AGGTCTCTGCCCGCATGATGACCCGCTACCAGAATAACTATCATTTTGGGGGGAATCTGTAA
 Primer design