SecReT4
Protein ID: 291289013
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_103
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]75314..77626 [+]
ProductTraD
Component typeTraD_F
UniProt IDD4HQM4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 9e-147, Aligned region: 172..561
TraD_N [PF12615], Evalue: 2.9e-32, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 9.5e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 6e-09, Aligned region: 400..491
T4SS-DNA_transf [PF02534], Evalue: 1.3e-06, Aligned region: 393..507
Protein Sequence: 770 a.a.     [Download]
>gi|291289013|ref|YP_003517516.1| TraD [Klebsiella pneumoniae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF
 
Nucleotide Sequence: 2313 bp     [Download]
>gi|291288912|ref|NC_013950.1|:75314-77626 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAGTTTCAATGCCAAAGATATGACGCAGGGCGGTCAGATCGCCAATATGCGCTTTCGCATGTTTGGTC
AGATTGCCAATATTATTTTCTACGTGCTGTTTATTTTATTCTGGGTGCTGTGCGGGCTGATGCTGATGTA
TCGGCTCAGCTGGCAAACCTTTGTGAACGGCTGCGTATACTGGTGGTGTACGACGCTGGGTCCGATGCGC
GATATTATTCGTTCCCAGCCGGTATACACCATTCAGTATTACGGCCAGTCGCTGGAATATACCTCAGAAC
AAATCCTGGCCGATAAATATACTATCTGGTGCGGAGAGCAGCTGTGGACCAGTTTCGTCTTTGCAGCCGT
GGTTTCTCTTGTTATCTGTATCGTGACGTTCTTCATCGCCAGTTGGGTGCTGGGCCGCCAGGGGAAACAG
CAGAGTGAGGATGAGAATACCGGCGGGCGCCAGCTTTCCGATAAGCCCAAAGAAGTGGCCCGCCAGATGA
AGCGTGATGGTATGGCCTCCGATATTAAAATTGGCGATCTGCCTATTCTTAAAAACTCCGAAATCCAGAA
CTTCTGCCTCCACGGTACCGTGGGTTCCGGTAAATCAGAAGTAATCCGCCGGCTACTGAATTATGTTCGT
GCCCGGGGCGATATGGCCATCATTTACGATCGCTCCTGTGAGTTCGTCAAAAGCTATTACGACCCGTCAC
TGGATAAAATCCTCAACCCGCTGGACTCGCGCTGCGCGGCCTGGGATTTGTGGAAAGAGTGCCTGACGCT
GCCGGACTTCGACAACATCTCCAACACTCTTATCCCGATGGGCACCAAAGAAGACCCGTTCTGGCAGGGC
TCCGGTCGCACTATCTTTGCCGAAGGCGCGTACCTGATGCGTGAAGACAAGGATCGCAGCTACGAGAAGC
TGGTTGATACCATGCTGTCCATTAAAATCGACAAGCTGCGCGCCTATCTGCAGAACACGCCGGCAGCGAA
CCTGGTTGAAGAGAAAATTGAGAAAACGGCCATCTCCATTCGTGCCGTGCTGACCAACTACGTCAAGGCT
ATTCGCTACCTGCAGGGCATCGAGAAGAACGGGGAGCCGTTCACTATCAGGGACTGGATGCGCGGTGTCC
GTGAGGACCGACCCAATGGCTGGCTGTTTATCTCCTCCAACGCTGACACCCATGCTTCCCTGAAGCCGGT
TATCTCGATGTGGCTGTCAATTGCTATCCGCGGCCTGCTGGCGATGGGGGAGAACCGTAACCGGCGCGTG
TGGATTTTCGCCGACGAGCTCCCCACGCTGCACAAGCTGCCGGACCTGGTCGAAATCCTCCCGGAGGCGC
GTAAATTTGGTGGTTGTTATGTGTTCGGTATTCAGTCCTATGCCCAGCTGGAAGATATCTATGGCGTCAA
GCCTGCCGCCACGCTCTTTGACGTGATGAACACCCGAGCCTTCTTCCGCTCCCCGAGTAAAGAGATTGCG
GAGTTTGCTGCCGGTGAAATTGGCGAGAAGGAAATCCTCAAGGCCAGCGAGCAGTACTCCTACGGTGCTG
ACCCGGTGCGTGATGGTGTATCGACCGGGAAAGAAAAAGAGCGGGAAACGCTGGTCAGTTACTCCGATAT
TCAGACGCTGCCTGACCTGTCCTGCTATGTCACGCTGCCCGGGCCGTATCCGGCCGTGAAACTGGCCCTC
AAATACAAACCGCGTCCGAAAATTGCCGAGGGATTTATTCCTCGCACTCTCGATGCGCGGGTGGATGCGC
GGCTCAGTGCGTTGCTTGAAGCGCGGGAAGCTGAAGGCAGTCTTGCCAGGGCACTTTTCACGCCGGATGC
GCCGGCATCCGGGCCCGCTGATACAAACAGTCACGCCGGTGAACAACCTGAGCCGGTCAGTCAGCCTGCG
CCAGCAGACATGACAGTATCTCCGGCACCGGTAAAAGCGCCGCCGACAACGAAGATGCCGGCAGAGGAAC
CTTCCGTCAGAGCAACGGAGCCTTCCGTCCTGCGGCTCACGACCGTACCGTTGATCAAGCCAAAAGCAGC
CGCTGCTGCCGCTGCAGCCGCAACAGCATCCTCTGCCGGTACCCCTGCTGCAGCTGCAGGCGGGACAGAA
CAGGAGCTGGCGCAGCAGTCTGCGGAACAGGGACAGGACATGCTGCCGGCCGGCATGAACGAGGACGGTG
TCATCGAGGACATGCAGGCGTATGACGCCTGGCTGGCAGATGAGCAGACACAGCGGGATATGCAGCGGCG
TGAGGAAGTCAATATCAACCACAGCCACCGCCACGATGAACAGGATTATGTCGAGATTGGGGGGAACTTC
TGA
 Primer design