SecReT4
Protein ID: 291289014
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_104
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]77626..82887 [+]
ProductTraI
Component typeTraI_F
UniProt IDD4HQM5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 2.3e-84, Aligned region: 7..288
TraI [PF07057], Evalue: 3e-57, Aligned region: 1433..1558
AAA_30 [PF13604], Evalue: 3.5e-43, Aligned region: 971..1158
UvrD_C_2 [PF13538], Evalue: 2e-05, Aligned region: 1340..1443
AAA_19 [PF13245], Evalue: 6e-05, Aligned region: 984..1047
Protein Sequence: 1753 a.a.     [Download]
>gi|291289014|ref|YP_003517517.1| TraI [Klebsiella pneumoniae]
MMSIGSVKSAGSAGNYYTDKDNYYVIGSMDERWQGKGAEALGIDGKAVDKALFTELLKGKLPDGSDLTRI
QDGANKHRPGYDLTFSAPKSVSVMAMLGGDKRLIDAHNQAVTEAVRQLETLAATRVMTDGKSETVLTGNL
IVAKFNHDTNRNQEPQIHTHAVVINATQNGDKWQSLGTDKIGKTGFIENVYANQIAFGKLYREAFKPLVE
KLGYETEVVGKHGMWEMKGVPVEPFSTRSQEVREAAGPDASLKSRDVAALDTRKSKDAIDPAEKMVEWMN
TLKETGFDIRGYREAADARAAELARAPAAPVNTDGPDITDVVTKAIAGLSDRKVQFTYADLLARTVGQLE
AKDGVFELARKGIDAAIEREQLIPLDREKGLFTSNIHVLDELAVKALSQEVQRQNHVSVTPDAFVVRQVP
FSDAVSVLAQDRPVMGIVSGQGGATGQRERVAELTLMAREQGRDVHILAADNRSRDFLAGDVRLAGETVT
GKSALQDGTAFIPGGTLIVDQAEKLSLKETISLLDGAMRHNVQVLLSDSGKRSGTGSALTVLKDSGVNTY
RWQGGHQTTADIISEPDKGARYSRLAQEFAVSVREGQESVAQISGTREQSVLNGLIRDSLRQEGVLGEKD
TTITALTPVWLDSKSRGVRDYYREGMVMERWDPETRTHDRFVIDRVTGSSNMLTLKDREGVRLDLKVSAV
DSQWTLFRADTLPVAEGERLAVLGKIPDTRLKGGESITVMKVEDGQLTVQRPGQKTTQTLAVGAGVFDGI
KIGHGWVESPGRSVSETATVFASVTQRELDNATLNQLAQSGSHLRLYSAQDAARTTEKLSRHTAFSVVSE
QLKTRSGETDLDAAIAQQKAGLRTPAEQAIHLAIPLLESEKLTFSRPQLLATALETGGGKVSMADIDTTI
QAQIRSGQLLNVPVAHGYGNDLLISRQTWDAEKSILTHVLEGKDAVAPLMDRVPASLMTDLTAGQRAATR
MILESTDRFTVVQGYAGVGKTTQLRAVMSAISLLPEETRPRVIGLAPTHRAVGEMQSAGVDARTTASFLH
DTQLLQRNGQTPDFSNTLFLLDESSMVGLADMAKAHSLIVAGGGRAVSSGDNDQLQPIAPGQPFRLTQQR
SAADVAIMKEIVRQMPELRPAVYSLIERDVHRALTTIEQVTPEQVPRKEGAWAPGSSVVEFTPKQEKAIE
KALSEGKTLPEGQPATLYEALVKDYTGRTPEAQSQTLVITHLNKDRRALNSLIHDARRENGETGKEEITL
PVLVTSNIRDGELRKLSTWTAHKEAVALVDNVYHRISKVDKANQLITLTDSEGKERYISPREASAEGVTL
YRQEKITVSQGDRMRFSKSDLERGYVANSIWEVQSVSGDSVTLSDGKLTRTLTPKADQAQQHIDLAYAIT
AHGAQGASEPYAIALEGVAGGREQMASFESAYVALSRMKQHVQVYTDNREGWIKAIKHSPEKATAHDILE
PRNDRAVKTADLLFGRARPLDETAAGRAALQQSGLAQGSSPGKFISPGKKYPQPHVALPAFDKNGKAAGI
WLSPLTDRDGRLEAIGGEGRIMGNEDARFVALQNSRNGESLLAGNMGEGVRMARDNPDTGVVVRLAGDDR
PWNPGAMTGGRVWAEPAPVAPVPQAGADIILPPEVLAQRAAEEQQRREMEKQAEQTAREVAGEARKAGEP
ADRVKEVIGDVIRGLERDRPGTEKTTLPDDPQFRRQEEAIQQVASERLQRERLQAVERDMVRDLNREKTL
GGD
 
Nucleotide Sequence: 5262 bp     [Download]
>gi|291288912|ref|NC_013950.1|:77626-82887 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGATGTCGATTGGCTCCGTTAAATCGGCGGGCAGTGCCGGTAATTACTATACGGATAAGGATAATTACT
ACGTCATAGGGAGCATGGACGAACGCTGGCAGGGTAAGGGGGCTGAGGCGCTGGGGATCGACGGGAAAGC
CGTGGATAAGGCGCTGTTTACGGAACTGCTGAAAGGGAAGCTGCCGGATGGCAGCGACCTGACCCGGATA
CAGGACGGCGCCAACAAGCACCGGCCCGGTTATGACCTGACCTTCTCGGCCCCCAAAAGCGTGTCGGTCA
TGGCGATGCTGGGCGGCGATAAACGCCTTATCGATGCCCACAACCAGGCGGTAACCGAAGCGGTGCGGCA
ACTGGAGACGCTGGCCGCGACCCGGGTCATGACGGACGGTAAAAGCGAAACGGTGCTGACCGGAAATCTG
ATTGTGGCGAAATTCAACCACGACACGAACCGTAACCAGGAACCTCAGATACACACCCATGCCGTCGTCA
TTAACGCCACGCAGAACGGGGACAAATGGCAGTCTCTCGGCACAGATAAGATCGGTAAAACAGGTTTTAT
CGAGAACGTGTACGCGAACCAGATAGCGTTCGGGAAGCTTTACCGGGAGGCGTTCAAACCCCTGGTTGAG
AAGCTTGGCTATGAGACGGAAGTTGTGGGCAAACACGGGATGTGGGAGATGAAAGGGGTCCCTGTGGAAC
CGTTCTCCACCCGGTCTCAGGAGGTCAGGGAGGCCGCAGGGCCCGATGCCTCCCTGAAGTCCCGGGATGT
GGCCGCGCTCGATACCCGCAAGTCGAAAGACGCCATCGATCCGGCAGAGAAGATGGTGGAGTGGATGAAC
ACGCTGAAGGAGACCGGGTTTGACATCCGGGGGTACCGTGAGGCCGCCGATGCGCGAGCCGCAGAGCTGG
CCCGTGCACCTGCCGCGCCGGTGAACACTGACGGTCCGGATATCACGGATGTGGTGACGAAAGCGATTGC
CGGTCTCAGCGACCGCAAGGTGCAGTTCACGTATGCCGACCTGCTGGCACGCACGGTCGGCCAGCTGGAG
GCGAAGGACGGTGTGTTTGAGCTGGCGAGAAAGGGCATCGATGCCGCCATTGAACGGGAGCAGCTTATCC
CTCTCGATCGCGAGAAAGGCCTGTTCACCTCAAACATCCACGTTCTCGATGAACTCGCCGTCAAAGCCCT
TAGTCAGGAGGTGCAGCGCCAGAATCATGTCTCCGTCACGCCTGATGCGTTTGTGGTGCGCCAGGTCCCT
TTCAGCGATGCCGTCAGTGTGCTGGCGCAGGATCGCCCGGTAATGGGTATCGTTTCCGGTCAGGGCGGTG
CCACCGGCCAGCGGGAGCGGGTGGCCGAGTTAACCCTGATGGCCCGGGAGCAGGGGCGTGACGTCCATAT
CCTGGCGGCCGATAACCGCTCACGTGATTTTCTCGCCGGTGATGTGCGTCTGGCCGGGGAAACGGTGACC
GGTAAATCCGCCCTGCAGGACGGGACGGCGTTTATTCCGGGCGGAACACTCATCGTGGATCAGGCGGAGA
AGCTGAGCCTGAAGGAAACGATTTCCCTGCTCGATGGTGCGATGCGCCATAACGTGCAGGTCCTGCTCTC
CGACAGCGGGAAGCGCAGCGGGACCGGCAGCGCGCTGACGGTGCTGAAGGACAGCGGCGTGAATACGTAT
CGCTGGCAGGGTGGCCATCAGACCACAGCCGACATCATCAGTGAACCGGATAAAGGAGCACGCTACAGCC
GGCTGGCACAGGAGTTTGCCGTCAGCGTGCGTGAAGGGCAGGAAAGCGTGGCCCAAATCAGCGGGACGCG
TGAACAGAGCGTACTCAACGGCCTTATCCGTGACTCCCTCAGACAGGAGGGGGTGCTGGGTGAGAAAGAC
ACGACCATTACAGCCCTGACGCCGGTGTGGCTGGACAGCAAAAGCCGGGGCGTGCGGGATTATTACCGGG
AGGGGATGGTGATGGAACGCTGGGATCCGGAGACCCGGACGCACGATCGCTTTGTCATTGACCGGGTGAC
CGGGAGCAGCAATATGCTGACCCTGAAAGACCGGGAAGGGGTCCGTCTGGATCTGAAGGTTTCCGCGGTC
GACAGCCAGTGGACGCTGTTCCGGGCAGATACACTGCCGGTGGCAGAGGGGGAACGTCTGGCGGTGCTCG
GGAAGATACCGGACACACGCCTGAAGGGCGGGGAAAGCATCACGGTGATGAAAGTGGAGGACGGGCAGCT
GACGGTACAGCGGCCGGGGCAGAAAACCACGCAGACCCTGGCCGTGGGCGCGGGCGTGTTTGACGGTATT
AAAATCGGCCACGGCTGGGTGGAAAGTCCCGGCAGGTCGGTTAGCGAGACGGCAACGGTCTTTGCGTCGG
TGACGCAGCGTGAGCTGGATAACGCCACCCTCAACCAGCTGGCGCAGAGCGGAAGTCATCTCCGGCTGTA
CTCGGCGCAGGATGCGGCGCGCACGACGGAGAAGCTGTCGCGGCATACCGCCTTCAGCGTGGTCTCAGAG
CAGCTGAAGACCCGATCCGGCGAGACGGACCTGGATGCGGCCATTGCGCAGCAGAAGGCCGGACTGCGTA
CCCCGGCAGAACAGGCCATTCACCTGGCCATCCCGCTGCTTGAAAGTGAGAAACTGACCTTCTCCCGGCC
CCAGCTGCTGGCGACGGCGCTGGAAACCGGGGGCGGGAAGGTTTCGATGGCGGACATCGACACGACCATC
CAGGCACAAATCAGGTCGGGGCAGTTGCTGAATGTACCGGTGGCGCACGGCTACGGCAATGACCTGCTGA
TTTCCCGTCAGACCTGGGACGCCGAAAAAAGCATCCTGACCCACGTGCTGGAAGGTAAAGACGCGGTGGC
CCCCCTGATGGACCGCGTGCCGGCCAGTCTGATGACGGACCTGACCGCCGGACAGCGGGCGGCGACCCGG
ATGATTCTGGAAAGCACGGACCGGTTCACGGTGGTTCAGGGGTATGCCGGGGTGGGGAAAACCACCCAGC
TCCGGGCAGTCATGAGTGCCATCAGTCTGCTGCCGGAAGAGACCCGTCCGCGCGTCATCGGTCTGGCGCC
GACGCATCGCGCGGTCGGGGAAATGCAGAGTGCTGGCGTGGATGCGCGCACGACGGCATCGTTCCTCCAC
GACACGCAGCTGCTACAGCGCAATGGCCAGACACCCGATTTCAGCAACACCCTGTTCCTGCTCGACGAGA
GCTCAATGGTGGGGCTGGCCGATATGGCAAAAGCCCACTCCCTCATCGTCGCCGGCGGTGGGCGGGCGGT
GTCCAGTGGGGATAACGACCAGCTGCAGCCCATCGCGCCGGGCCAGCCGTTCAGGCTGACGCAGCAGCGC
AGCGCCGCCGACGTTGCCATCATGAAAGAGATTGTACGCCAGATGCCTGAGCTGCGACCGGCGGTCTACA
GCCTGATTGAGCGGGATGTGCACCGCGCCCTGACCACCATCGAGCAGGTCACGCCGGAGCAGGTGCCGAG
AAAAGAAGGCGCCTGGGCGCCGGGCAGTTCTGTGGTGGAATTCACGCCAAAGCAGGAAAAGGCGATAGAA
AAGGCGCTGAGCGAGGGGAAAACCCTGCCGGAAGGTCAGCCCGCGACGCTCTACGAGGCGCTGGTGAAGG
ACTATACCGGACGGACCCCGGAGGCACAGTCGCAGACGCTGGTGATCACCCATCTGAATAAGGACCGGCG
GGCGCTGAACAGTCTGATCCATGACGCACGGCGGGAGAACGGGGAAACCGGCAAAGAGGAAATCACCCTG
CCGGTGCTGGTCACGAGTAACATCCGTGACGGTGAACTGCGCAAACTGTCGACCTGGACGGCTCACAAGG
AGGCGGTGGCGCTGGTTGATAACGTATACCACCGTATCAGCAAGGTGGATAAGGCTAATCAGCTGATCAC
CCTGACAGACAGTGAAGGAAAGGAGCGATATATCTCACCCCGGGAGGCATCGGCAGAAGGCGTCACGCTC
TATCGTCAGGAAAAGATAACCGTGTCTCAGGGGGACCGAATGCGCTTCAGCAAAAGTGACCTGGAGCGCG
GCTATGTGGCCAACAGTATCTGGGAGGTGCAGTCTGTTTCGGGTGACAGTGTCACGCTATCTGATGGCAA
ACTCACCCGTACGCTGACCCCGAAGGCGGATCAGGCGCAGCAGCATATCGACCTCGCCTACGCCATTACG
GCCCACGGCGCCCAGGGGGCCAGCGAACCGTATGCCATCGCGCTGGAAGGGGTGGCCGGTGGTCGGGAAC
AGATGGCCAGCTTTGAGTCTGCCTATGTGGCGTTATCCCGCATGAAACAGCATGTTCAGGTCTACACCGA
CAACCGTGAGGGCTGGATAAAGGCCATCAAGCATTCACCTGAGAAAGCGACGGCGCACGATATTCTTGAA
CCCCGTAACGACCGGGCGGTGAAAACAGCCGATCTGCTGTTCGGGCGGGCAAGGCCACTGGATGAAACCG
CCGCGGGCCGGGCAGCCCTGCAGCAGTCCGGTCTGGCACAGGGAAGTTCACCAGGAAAATTCATTTCTCC
GGGGAAAAAGTACCCTCAGCCGCATGTGGCGCTGCCGGCATTTGATAAAAACGGGAAAGCCGCCGGTATC
TGGCTCAGCCCGCTGACCGATCGGGACGGACGGCTGGAGGCTATCGGCGGAGAGGGACGAATTATGGGCA
ATGAAGACGCCCGGTTCGTGGCGCTGCAGAACAGCCGCAACGGAGAAAGCCTGCTGGCCGGGAATATGGG
GGAGGGCGTCAGAATGGCCCGCGACAATCCCGATACGGGGGTGGTGGTGCGGCTGGCCGGTGATGACCGC
CCCTGGAACCCCGGGGCCATGACCGGTGGGCGGGTATGGGCTGAACCGGCGCCGGTGGCTCCGGTACCGC
AGGCCGGGGCTGACATTATCCTCCCGCCAGAGGTACTGGCACAGCGGGCGGCAGAAGAACAGCAGCGCCG
GGAAATGGAAAAACAGGCGGAACAGACTGCCCGGGAAGTGGCCGGGGAGGCGCGTAAAGCCGGCGAGCCG
GCGGACCGGGTGAAAGAGGTTATCGGGGACGTCATTCGCGGACTGGAGCGTGACCGGCCGGGTACGGAGA
AAACGACGCTACCGGATGATCCTCAGTTCCGGCGCCAGGAGGAGGCGATTCAGCAGGTGGCCTCAGAACG
TCTGCAGCGTGAGCGTCTGCAGGCTGTGGAGCGGGACATGGTTCGTGACCTTAACCGCGAGAAAACACTC
GGGGGCGACTGA
 Primer design