SecReT4
Protein ID: 291289015
T4SS name [ID]Tra_F [116]
Gene symbol-
Locus tagpKF94_105
StrainKlebsiella pneumoniae plasmid pKF3-94 (NC_013950)
Repliconplasmid pKF3-94 [GenBank: NC_013950] [Browse all T4SS(s) in this replicon]
Location [Strand]82968..83693 [+]
ProductTraX
Component typeTraX_F
UniProt IDD4HQM6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 5.6e-51, Aligned region: 25..239
Protein Sequence: 241 a.a.     [Download]
>gi|291289015|ref|YP_003517518.1| TraX [Klebsiella pneumoniae]
MRAQHTFPGATDSWLQRLLTWTPGQTDMIKTVALVLMVTDHTGLLLAGNNEVMRLLGRGCFPLFGLAWGM
NLARHAEIRQSQLNSLWGWALVAQVSFMLIGYPWYTGNILFAFAVTGQVLRWVSQPSWYYTLPAAGLLVT
WIPLSTGSYGMAGVGMLTASWLLCRAQHAPERLGYGVLWALMVLLMNMHDVSESVAGLAIALLTLMVCSS
AGERVKRFWPRQFFVMFYAVHLAVLGIVVSM
 
Nucleotide Sequence: 726 bp     [Download]
>gi|291288912|ref|NC_013950.1|:82968-83693 Klebsiella pneumoniae plasmid pKF3-94, complete sequence
ATGAGAGCACAACACACATTTCCAGGCGCGACAGACAGCTGGCTTCAGCGCCTGCTGACCTGGACACCGG
GACAAACGGATATGATTAAAACGGTCGCACTGGTACTGATGGTGACTGACCACACCGGCTTACTGCTGGC
CGGAAACAATGAAGTGATGCGCCTGCTGGGACGTGGTTGTTTTCCGCTGTTCGGTCTGGCATGGGGAATG
AATCTGGCACGGCACGCGGAAATACGCCAGTCTCAACTGAACAGCCTGTGGGGCTGGGCGCTGGTCGCCC
AGGTGTCGTTTATGCTCATCGGGTACCCGTGGTATACCGGGAATATTCTGTTTGCCTTTGCCGTTACGGG
CCAGGTCCTGCGGTGGGTCAGCCAGCCGTCCTGGTATTACACCCTCCCGGCGGCTGGACTGCTGGTCACC
TGGATACCCCTGTCAACCGGCAGCTACGGCATGGCCGGAGTGGGCATGCTCACCGCCAGCTGGCTGCTTT
GTCGCGCACAGCATGCACCGGAACGGCTGGGATACGGGGTGTTGTGGGCCCTCATGGTGTTGCTGATGAA
TATGCATGACGTGAGTGAATCAGTGGCCGGACTGGCGATTGCGCTGCTGACGCTGATGGTGTGCTCATCT
GCCGGAGAACGTGTGAAACGCTTCTGGCCGCGGCAGTTCTTCGTGATGTTCTATGCCGTGCACCTGGCGG
TACTGGGTATTGTCGTCTCAATGTGA
 Primer design