SecReT4
Protein ID: 291289295
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_099
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]70476..75746 [-]
ProductTraI
Component typeTraI_F
UniProt IDD4HQY5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 1.1e-88, Aligned region: 7..287
TraI [PF07057], Evalue: 1e-58, Aligned region: 1434..1560
AAA_30 [PF13604], Evalue: 2.8e-42, Aligned region: 968..1156
UvrD_C_2 [PF13538], Evalue: 1.7e-05, Aligned region: 1341..1444
AAA_19 [PF13245], Evalue: 2.1e-05, Aligned region: 982..1047
Protein Sequence: 1756 a.a.     [Download]
>gi|291289295|ref|YP_003517627.1| TraI [Klebsiella pneumoniae]
MLSFSVVKSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQDPQLHTHVVVANVTQHNGEWKTLSSDKVGKTGFSENVLANRIAFGKIYQSELRQRVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLLEGMAFPPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTEAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDEPRTAEKLARHPSFTVVSDQI
KARAGETLLETAISLQKAGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVVIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGTSETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVF
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGRSAG
IWLNPLTTDDGNGLRGFSGEGRVKGRGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDSSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTELAVRDIAGQERDRTASSERETALPESVLRESQREREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD
 
Nucleotide Sequence: 5271 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c75746-70476 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGTTGAGTTTCAGCGTTGTTAAATCGGCAGGCAGTGCCGGAAACTATTACACCGACAAGGATAATTACT
ATGTGCTGGGCAGCATGGGAGAACGCTGGGCCGGTCAGGGGGCTGAACAGCTTGGGCTGCAGGGCAGCGT
CGATAAGGATGTTTTTACCCGTCTTCTGGAGGGCAGGCTGCCGGACGGGGCGGATTTAAGCCGCATGCAG
GATGGCAGTAATAAGCATCGTCCCGGCTACGACCTGACCTTCTCCGCCCCCAAAAGTGTCTCCATGATGG
CCATGCTCGGGGGGGATAAACGTCTTATTGATGCACATAACCAGGCTGTGGATTTTGCTGTCCGTCAGGT
GGAGGCGCTGGCTTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTGCTGACCGGTAATCTGGTG
ATGGCACTGTTTAACCATGACACCAGTCGCGATCAGGACCCACAGTTACACACGCATGTGGTGGTGGCTA
ATGTCACGCAGCATAACGGCGAATGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACCGGATTTTCCGA
GAACGTGCTCGCGAACCGGATTGCGTTCGGGAAAATATATCAGAGTGAGTTACGTCAGCGCGTTGAGGCG
CTGGGTTATGAAACCGAAGTGGTCGGTAAGCACGGTATGTGGGAGATGCCGGGCGTACCGGTGGAAGCCT
TCTCCGGACGCTCACAGGCTATCCGGGAGGCCGTCGGTGAAGACGCCTCGCTGAAATCCCGGGATGTGGC
GGCACTGGATACGCGTAAATCCAAACAGCACGTCGATCCTGAAGTCAGAATGGCTGAATGGATGCAGACG
CTGAAGGAAACCGGGTTCGACATCCGGGCATATCGTGACGCGGCGGATCAGCGTGCGGAGATCCGCACGC
AGGCGCCCGGGCCTGCTTCACAGGACGGGCCGGATGTGCAGCAGGCGGTGACACAGGCCATTGCCGGATT
AAGTGAACGAAAAGTGCAGTTCACGTATACGGACGTGCTGGCCAGGACGGTCGGCATACTGCCGCCGGAA
AATGGTGTGATTGAACGGGCACGCGCCGGTATCGATGAGGCCATCAGCCGTGAGCAGCTTATCCCCCTCG
ATCGTGAGAAGGGGCTGTTCACGTCCGGGATTCATGTGCTCGATGAGCTGTCAGTCCGGGCACTCAGTCG
TGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTCCCCCGGACGGCCGGTTACAGC
GATGCCGTCAGTGTTCTGGCACAGGATCGCCCGTCGCTGGCCATTGTGTCCGGGCAGGGCGGTGCAGCCG
GGCAGCGTGAGCGGGTGGCTGAACTGGTCATGATGGCCCGGGAGCAGGGGCGGGAGGTGCAGATTATCGC
TGCTGACCGTCGCTCGCAGATGAACCTGAAGCAGGATGAACGGCTGTCCGGTGAACTGATAACCGGACGT
CGTCAGTTGCTGGAAGGCATGGCCTTCCCGCCGGGCAGTACCGTTATCGTCGACCAGGGCGAAAAACTCT
CCCTGAAAGAGACGTTAACCCTGCTGGATGGTGCCGCACGTCATAACGTACAGGTCCTGATAACCGACAG
CGGGCAGCGAACCGGTACAGGCAGTGCACTGATGGCCATGAAGGATGCCGGGGTGAACACATATCGCTGG
CAGGGGGGAGAACAGCGACCGGCCACCATCATCAGTGAACCGGACCGTAATGTCCGCTATGCCCGGCTGG
CCGGAGATTTTGCGGCCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCACAGGTCAGCGGGGTACGGGAACA
GGCCATACTGACAGAGGCCATTCGCAGTGAGCTGAAAACGCAGGGCGTGCTCGGACACCCTGAGGTGACC
ATGACTGCACTGTCACCGGTCTGGCTGGACAGCCGGAGCCGTTATCTGCGGGATATGTACCGACCGGGGA
TGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTCATGACCGCTATGTGATAGACCGGGTGACAGCGCA
GAGTCACAGCCTGACCCTGCGGGATGCGCAGGGCGAAACGCAGGTGGTGCGTATTTCCTCCCTGGACAGC
AGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGCGACTGAGGGTGACAGGGAAAA
TTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGGCATCCGTCAGTGAAGATGCGATGACGGT
TGTTGTGCCGGGGCGGGCTGAACCGGCCACCCTGCCTGTGGCTGATTCACCATTCACGGCACTGAAGCTG
GAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGCGACAGTGCGACGGTTTTTGCCTCCGTCACAC
AGATGGCGATGGACAACGCGACCCTGAACGGTCTGGCCCGCAGTGGTCGTGATGTCCGGCTGTATTCCTC
GCTGGATGAACCCCGTACTGCGGAAAAACTTGCCCGCCATCCCTCCTTTACGGTGGTTTCTGATCAGATA
AAGGCGCGTGCCGGTGAGACATTGCTGGAAACCGCTATCAGTCTGCAGAAAGCCGGGCTTCACACGCCGG
CACAGCAGGCCATTCATCTGGCCCTTCCTGTGCTGGAAAGTAAAAACCTGGCCTTCAGCATGGTGGACCT
GCTGACAGAGGCGAAGTCGTTTGCTGCAGAAGGAACCGGTTTTACTGAACTGGGAGGGGAAATCAATGCG
CAGATAAAACGCGGTGACTTACTGTATGTGGATGTGGCAAAAGGCTATGGCACAGGTCTGCTGGTTTCCC
GTGCGTCGTATGAGGCAGAAAAAAGTATTCTTCGCCATATTCTCGAAGGTAAGGAGGCGGTCACGCCGTT
GATGGAGAGAGTACCCGGCGAACTCATGGAGACGTTAACGTCGGGACAGCGTGCCGCCACCCGTATGATA
CTGGAAACGTCCGACCGTTTCACGGTGGTACAGGGTTATGCCGGTGTGGGTAAGACCACACAGTTCCGGG
CGGTGATGTCAGCCGTGAACATGCTGCCGGCGAGTGAGCGTCCCCGAGTTGTGGGGCTGGGGCCCACGCA
CCGTGCGGTCGGTGAGATGCGCAGCGCCGGCGTGGATGCACAGACGCTGGCGTCCTTTCTGCATGACACG
CAGCTGCAGCAGCGCAGCGGAGAAACGCCGGATTTCAGCAACACGCTGTTCCTGCTCGATGAGAGCTCAA
TGGTGGGCAATACCGATATGGCACGGGCATACGCCCTGATTGCGGCCGGTGGCGGTCGTGCCGTGGCCAG
TGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGTCTGCAGCAGACGCGCAGTGCT
GCCGATGTGGTCATCATGAAGGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCCTGA
TTAACCGGGATGTGGAAAGGGCACTGTCCGGGCTTGAGAGTGTGAAACCGTCTCAGGTTCCCCGTCAGGA
GGGCGCATGGGCACCGGAGCACTCCGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAAGCG
CAGCAGAAGGCGATGCTGAAAGGCGAGGCTTTCCCGGATATCCCCATGACACTGTATGAGGCCATTGTCC
GCGACTATACCGGCAGGACACCGGAAGCACGGGAGCAGACGCTGATTGTCACGCACCTGAATGAGGACCG
GCGCGTACTGAACAGCATGATTCATGATGCACGGGAAAAGGCCGGTGAGCTGGGCAAAGAGCAGGTCATG
GTGCCTGTCCTGAACACAGCGAATATACGTGACGGAGAACTGCGTCGTCTCTCCACCTGGGAGAATAACC
CGGATGCCCTTGCCCTGGTGGATAGTGTGTATCACCGGATTGCCGGTATCAGCAAGGATGACGGGCTGAT
AACCCTGGAGGATGCGGAAGGTAACACGCGGCTGATTTCGCCCCGGGAGGCGGTGGCTGAAGGTGTCACA
CTGTACACACCAGACAAAATCCGGGTGGGAACCGGTGACCGGATGCGCTTCACGAAGAGTGACCGGGAGC
GCGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCGGTTTCCGGTGACAGTGTCACGCTGTCGGACGG
ACAGCAGACCCGGGTGATTCGCCCCGGTCAGGAGCGGGCAGAGCAACATATTGACCTGGCCTATGCCATC
ACCGCCCACGGTGCGCAGGGGACAAGTGAAACCTTTGCCATTGCGCTTGAAGGCACGGAAGGTAACCGGA
AACTGATGGCAGGCTTTGAGTCAGCCTACGTGGCCCTGTCGCGTATGAAGCAGCATGTGCAGGTGTACAC
CGATAACCGTCAGGGCTGGACGGATGCCATTAACAATGCCGTACAGAAAGGAACAGCCCACGATGTGTTT
GAGCCGAAACCGGACCGGGAGGTCATGAATGCGCAGCGGCTGTTCAGTACGGCACGGGAACTGCGGGACG
TGGCGGCAGGCCGTGCCGTTCTCCGTCAGGCGGGGCTGGCCGGGGGAGACAGCCCTGCACGGTTTATTGC
ACCGGGACGTAAATATCCGCAGCCGTATGTGGCACTGCCGGCGTTTGACCGTAACGGCAGGTCCGCCGGT
ATCTGGCTGAACCCACTGACCACGGATGACGGAAACGGGCTGCGGGGATTCAGCGGTGAAGGACGGGTGA
AAGGCCGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGCAGCCGTAACGGAGAGAGCCTGCTGGCTGATAA
TATGCAGGATGGTGTCCGGATTGCCCGTGATAATCCCGACAGCGGTGTGGTGGTAAGAATTGCCGGTGAA
GGTCGTCCGTGGAATCCCGGTGCCATCACCGGTGGTCGCGTGTGGGGGGATATCCCGGACAGCAGCGTCC
AGCCGGGGGCCGGAAATGGCGAACCGGTCACGGCAGAGGTGCTGGCACAGCGGCAGGCTGAAGAGGCCAT
CCGCCGTGAAACGGAACGTCGCGCAGATGAAATTGTCCGTAAAATGGCAGAGAACAAACCTGACCTGCCG
GACGGCAAAACAGAGCTGGCTGTCAGGGATATTGCCGGGCAGGAACGTGACCGGACTGCCAGTTCTGAAC
GGGAAACCGCACTGCCGGAGAGTGTGCTGCGTGAATCACAACGGGAACGGGAAGCGGTCCGGGAGGTTGC
CCGGGAAAATCTGCTGCAGGAGCGTCTGCAGCAGATGGAGCGGGATATGGTTCGTGACCTGCAGAAAGAG
AAAACCCTGGGCGGAGACTGA
 Primer design