SecReT4
Protein ID: 291289298
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_104
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]80227..83010 [-]
ProductTraG
Component typeTraG_F
UniProt IDD4HQY8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.6e-119, Aligned region: 2..438
Protein Sequence: 927 a.a.     [Download]
>gi|291289298|ref|YP_003517630.1| TraG [Klebsiella pneumoniae]
MRNNLNAIAAFMSTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDN
SDLVKVHRVDNVPVGLAMPLSLTTRIGHAMVVSYEMIFTQPDSVTYSKTGMLFGANLIVKSTDFLSRNPE
IINLFQDYVQNCVLGDIYLNHKYTLEDLMASADPYTLIFSRPSPLRGVYDNNNNFITCKDASVTLKDRLN
LDTKTGGKTWHYYVQQIFGGRPDPDLLFRQLVSDSYSYFYGSSQSASQIMRQNVTINALKEGITSNAARN
GDTASLVNLATTSSMEKQRLAHVSIGHVTMRNLPMVQTILTGIAIGIFPLLVLAAVFNKLTLSVLKGYVF
ALMWLQTWPLLYAILNSAMTFYAKMNGAPVVLSELSQIQLKYSDLASTAGYLSAMIPPLSWMMVKGLGAG
FSSVYSHFASSSISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQTGSGATATQTRDG
NMVMDASGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNTLSQFGSNRGSSDSVT
GGADSTMSAQDSMMASRMRSAMESYAKAHNISNEQATQELASRSTRASAGMYGDAHAEWGVKPKILGVGG
GLGVRGGGRAGIDWSDDDAHQASSGSRASNDARHDIDARATQDFKEASDYFTSRKVSESGSHTDNNADSR
VDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEDLSQQFAQYVMKHAPQDAEAILTNTS
SPEIAERRRAMAWSFVQEQIQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGHQAIIEQRTQDSN
IRNDVKHQVDNMVTEYKGNIGDTQNSIRGEENIVRGQYSELQNHHKTEALSQNNKYNEEKSVQERMPGAD
SPQELMKRAKEYQDKYK
 
Nucleotide Sequence: 2784 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c83010-80227 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
TTGCGGAATAACCTGAACGCCATTGCGGCATTTATGAGTACGCGGACCTGGGATTCCATCGAAAAAATTG
CGCTCACATTGTCTGTTCTCGCGGTGGCCGTGATGTGGGTACAGCGGCACAACGTGATGGATTTGCTGGG
CTGGGTGGCCGTGTTTGTGCTTATCAGCCTGCTGGTTAATGTCCGTACATCGGTGCAGATTATTGATAAC
AGTGACCTGGTCAAAGTCCATCGGGTGGATAATGTGCCGGTCGGTCTGGCGATGCCACTTTCACTGACGA
CACGTATCGGGCATGCAATGGTGGTCAGCTACGAGATGATATTCACCCAACCGGACAGCGTCACCTACAG
CAAGACAGGCATGCTGTTCGGGGCGAATCTGATTGTGAAAAGCACCGATTTCCTGTCCCGGAATCCGGAA
ATCATCAATCTGTTCCAGGACTACGTCCAGAACTGCGTGCTGGGTGATATTTACCTGAATCATAAATACA
CGCTGGAAGATCTGATGGCCTCCGCTGACCCCTACACGCTGATTTTTTCCCGACCCAGCCCGCTACGGGG
CGTTTATGACAACAATAATAATTTCATAACCTGTAAGGATGCGTCGGTCACGCTGAAAGACAGGCTGAAT
CTCGATACAAAGACGGGAGGCAAGACCTGGCATTATTATGTGCAGCAGATATTTGGCGGCAGACCGGACC
CGGACCTGTTATTCAGACAACTGGTCAGTGACAGTTACAGTTATTTCTACGGCTCCAGTCAGTCTGCCAG
CCAGATTATGCGCCAGAACGTCACAATAAATGCCCTGAAAGAGGGTATCACCAGTAATGCCGCCCGTAAT
GGTGACACCGCCAGCCTGGTGAATCTGGCCACCACGTCATCGATGGAGAAGCAACGTCTGGCGCATGTCT
CTATCGGTCATGTGACAATGCGAAACCTGCCAATGGTACAGACTATCCTGACGGGAATTGCCATTGGTAT
TTTCCCGCTTCTGGTACTGGCAGCTGTCTTCAACAAACTGACACTGTCCGTCCTGAAAGGCTATGTGTTT
GCCCTGATGTGGCTGCAGACCTGGCCGTTGTTGTATGCCATTCTGAACAGTGCCATGACATTCTATGCGA
AGATGAATGGTGCGCCGGTCGTGCTGTCTGAACTCTCTCAGATACAGCTGAAATACTCTGACCTGGCCTC
TACTGCCGGGTATCTTTCAGCCATGATCCCCCCGTTGTCATGGATGATGGTAAAAGGCCTTGGCGCAGGT
TTTTCCAGCGTGTACAGCCACTTCGCCTCTTCCTCTATCAGTCCGACGGCCAGTGCAGCAGGCAGTGTGG
TTGACGGTAATTACTCCTACGGCAACATGCAGACGGAAAACGTGAACGGCTTCAGCTGGAGCACCAACAG
CACCACGTCGTTTGGTCAGATGATGTACCAGACCGGCAGTGGCGCAACTGCCACACAGACCCGTGACGGT
AATATGGTGATGGATGCAAGCGGAGCGATGTCCCGGTTACCGGTTGGTATCAATGCAACGCGTCAGATTG
CAGCGGCACAACAGGAAATGGCCCGGGAGGCGTCGAACAGAGCAGAAAGTGCCCTGCATGGTTTCAGCAG
CAGTATTGCCAGTGCCTGGAACACGCTCAGTCAGTTTGGTTCTAACCGGGGGAGCAGTGATTCTGTCACC
GGTGGCGCTGACAGCACCATGAGTGCACAGGATTCCATGATGGCCAGCCGTATGCGCAGTGCAATGGAAA
GCTATGCGAAGGCGCATAATATCAGTAATGAGCAGGCGACTCAGGAACTGGCATCCAGAAGTACGAGAGC
TTCTGCCGGGATGTATGGCGATGCTCATGCTGAATGGGGGGTTAAACCTAAAATTCTTGGTGTTGGTGGA
GGATTAGGCGTTAGAGGCGGTGGTCGGGCTGGCATTGACTGGAGTGATGATGATGCGCATCAGGCCAGCA
GTGGTTCACGGGCCAGCAATGATGCTCGTCATGATATCGATGCCAGAGCTACACAAGACTTTAAAGAGGC
CAGCGATTACTTTACCAGTCGCAAGGTCAGTGAGTCCGGCAGCCATACTGACAATAATGCTGATTCCCGT
GTGGATCAGTTGTCTGCAGCCCTGAATTCAGCGAAGCAGAGTTACGACCAGTACACGACGAATATGACTC
GCAGCCATGAATATGCTGAAATGGCATCCCGTACTGAAAGCATGAGTGGGCAGATGAGTGAAGACTTGTC
GCAACAGTTTGCACAGTATGTAATGAAACACGCGCCACAGGATGCAGAAGCTATTCTGACAAATACCAGT
TCACCGGAGATTGCAGAACGCCGTCGGGCGATGGCCTGGTCTTTTGTGCAGGAACAGATACAGCCTGGTG
TTGATAATGCCTGGCGGGAATCCCGTGGCGATATTGGTAAAGGAATGGAGAGCGTACCTTCGGGTGGTGG
CAGTCAGGATATTATTGCTGACCATCAGGGACATCAGGCCATTATTGAGCAAAGAACGCAGGACAGTAAT
ATCCGTAATGATGTAAAACATCAGGTTGATAATATGGTCACAGAATATAAAGGGAATATAGGTGATACTC
AGAACAGCATACGTGGCGAGGAAAATATTGTAAGAGGACAGTATTCTGAACTACAGAATCACCATAAAAC
AGAGGCATTATCTCAGAATAATAAATATAATGAAGAAAAGTCGGTTCAGGAAAGAATGCCCGGGGCTGAC
AGTCCACAGGAACTGATGAAAAGGGCAAAGGAGTATCAGGATAAGTATAAGTAA
 Primer design