SecReT4
Protein ID: 291289299
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_105
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]83042..84415 [-]
ProductTraH
Component typeTraH_F
UniProt IDD4HQY9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 7.5e-120, Aligned region: 29..378
Protein Sequence: 457 a.a.     [Download]
>gi|291289299|ref|YP_003517631.1| TraH [Klebsiella pneumoniae]
MLRIKPLLVLCAALLTFTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQVKNI
QLISMTLPDINAGCGGIDAYLGSFSFINGDQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKMA
SDINSMNLSSCQVAQGLVGGLFPQTQESQQKVCQDIGSESNIFADWAASRQGCTVGGQSSSVRDKASDKD
KERVLKNQNIIWEALKKNRMFDGNKELKEFIMTLTGTLIFGEDSEITPLPARTTDRDILRAIMEGGTAKI
YHCNDSDKCLKVVADANVTIARDKALKSQITKLLTSIQNKAVSDTPLDAREQGFISSTTIPVFKYLIDPQ
MLGVSNSVVYQLTDYIGYDIMLQYIQELLQQARAMIATGNYPQAVMDNVLENLNQAQQQIAIFQSQVQVQ
QDALLVVERQMSYMRQQLSARMLSRYQNNYHFGGNSL
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c84415-83042 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGCTTCGCATTAAACCTCTTCTGGTTCTTTGTGCCGCTTTACTGACGTTCACACCCGCAGCGTCAGCGG
ATGTGAACAGCGATATGAATCAGTTCTTTAACAAGCTGGGCTTCGCCTCCAATACCACACAGCCGGGCGT
CTGGCAGGGGCAGGCCGCCGGGTATGCCTATGGTGGCTCCCTGTATGCCCGCACCCAGGTCAAAAATATC
CAGCTGATTTCCATGACGCTGCCGGATATCAATGCCGGATGTGGCGGCATCGACGCCTATCTCGGCTCGT
TCAGTTTTATTAATGGCGATCAGTTGCAGCGTTTTGTTAAGCAGATTATGAGCAATGCTGCCGGTTACTT
TTTTGACCTTGCCCTGCAGACAACGGTGCCGGAAATAAAAACCGCAAAAGACTTCCTGCAGAAAATGGCA
AGTGACATTAACAGTATGAACCTCAGTTCCTGTCAGGTGGCACAGGGGCTTGTGGGGGGGCTGTTCCCTC
AGACGCAGGAATCTCAGCAGAAAGTTTGTCAGGACATTGGCAGTGAAAGCAATATCTTCGCCGACTGGGC
CGCATCTCGTCAGGGGTGCACGGTCGGAGGGCAGTCCTCATCTGTTCGTGACAAAGCCAGCGACAAGGAC
AAGGAGCGGGTGCTGAAAAACCAGAATATCATATGGGAGGCGCTGAAAAAAAACAGAATGTTTGACGGCA
ACAAAGAGTTGAAAGAATTTATCATGACGCTCACCGGTACGCTGATTTTTGGGGAAGACAGCGAGATTAC
CCCCCTGCCGGCGCGTACCACTGACCGCGATATCCTCCGGGCGATTATGGAGGGGGGAACGGCAAAAATT
TACCACTGCAACGATTCGGACAAGTGTCTGAAGGTGGTGGCGGATGCAAATGTGACCATCGCCCGGGATA
AAGCCCTGAAGTCACAGATTACAAAACTGCTCACCAGTATTCAGAATAAAGCAGTGAGTGACACTCCGCT
TGACGCCCGGGAACAGGGGTTTATTTCCAGCACCACCATTCCCGTTTTTAAATATCTGATTGACCCGCAG
ATGCTCGGTGTGTCCAACAGCGTCGTTTACCAGCTGACGGACTATATCGGCTACGACATCATGCTCCAGT
ACATTCAGGAACTGCTTCAGCAGGCCCGGGCCATGATTGCCACCGGGAACTATCCGCAGGCTGTGATGGA
CAATGTTCTGGAGAATCTGAATCAGGCACAGCAACAGATTGCCATTTTCCAGAGCCAGGTACAGGTCCAG
CAGGATGCGCTGCTGGTTGTCGAACGTCAGATGAGCTACATGCGCCAGCAGCTTTCCGCCCGTATGCTCA
GCCGTTACCAGAACAACTATCACTTCGGAGGGAATTCACTGTGA
 Primer design