SecReT4
Protein ID: 291289303
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_109
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]85584..85868 [-]
ProductTraQ
Component typeTraQ_F
UniProt IDD4HQZ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.4e-49, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|291289303|ref|YP_003517635.1| TraQ [Klebsiella pneumoniae]
MISKCRFSLPRLDITGMWVFALGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c85868-85584 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGATAAGTAAATGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTGCTCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design