SecReT4
Protein ID: 291289309
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_115
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]88325..89101 [-]
ProductTraF
Component typeTraF_F
UniProt IDD4HQZ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.9e-78, Aligned region: 34..248
Protein Sequence: 258 a.a.     [Download]
>gi|291289309|ref|YP_003517641.1| TraF [Klebsiella pneumoniae]
MMKEKMMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQ
TATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAAD
QAQQRQAIAKLAEYYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQ
RLGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPKF
 
Nucleotide Sequence: 777 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c89101-88325 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGATGAAAGAAAAAATGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCT
TTATTTTTCCGGCGTCAGGGAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAA
AGAAAATAAACCTGTACCTGCAGCCCCCCGTCAGGAGCCGGATATTATGCAGAAACTGGCCGCGCTGCAG
ACGGCAACAAAGCGGGCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCC
GGCTGCAGAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGTGCTAAAAAGGCCATGCTGGCACA
TCCCGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCGGCAGAC
CAGGCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAATACTACGGCATCATGTTTTTTTACCGGGGGC
AGGACCCCATCGACGGGCAGCTGGCGCAGGTCATTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTAT
TCCCGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAG
CGCCTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTAT
CATACGGCTTTATTTCGCAGGACGACCTGGCAAAACAATTCCTGAACGTTTCTGAAGATTTTAAACCAAA
ATTTTAA
 Primer design