SecReT4
Protein ID: 291289311
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_117
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]89345..91195 [-]
ProductTraN
Component typeTraN_F
UniProt IDD4HR01
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 5.7e-77, Aligned region: 322..566
Protein Sequence: 616 a.a.     [Download]
>gi|291289311|ref|YP_003517643.1| TraN [Klebsiella pneumoniae]
MKRILPLILALVTGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGFKPQESIPGYNANPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQQINRS
EFTNYTCERDTMVEEYCSRTASITGDWKYTDEYREVTIPHSQFRFSMNGLKLVFSVTVPVAGTVESASLS
VHAGLYFLNSRYDFMNTTFNVQLVTGQSGTFTIPVPSGFSVTQGQVLTGSGCTANGNCLPHGNGDRKVYE
SLVSGASTFTLKLRMKVRDKEWVPRVEWVESCPFNKADGVLKGTECSEPGGTKTGVMEGKPWSITQACWA
YRDKYVTQSADNGTCQKYVDNPACTLASRQCAFYSDEGTCLHEYATYSCESKTSGKVMVCGGDVFCLDGE
CDKAQSGKSSDFGEAVSQLAALAAAGKDVAALNGVDVRAFTGEAKFCRKAAAGFSNCCKDGGWGQDVGLA
KCNSEEKALGKAKDNKLTVSVGEFCSKKVLGVCLQKKRSYCQFDSKLAQIVQQQGRNGQLRIGFGSAKHP
DCRGITVDELQKIQFDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c91195-89345 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGAAACGTATTTTACCTCTGATACTGGCTCTGGTTACCGGTATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGTTCTGATTTTGCTCACCAGATCAAAGGGCAGGGAAGCAGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGTATCCCCGGCTATAACGCGAATCCGGACGAGACAAAATATTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACTATCACAG
AGTCATTCATGAACAAGCCGAAAGACATTCTTTCACCGGATGCGCCGTTTATCCAGACCGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAACACCGGGCAGCAGTGCAGTGCGCAGCAGATAAACCGCAGT
GAGTTCACAAACTATACCTGTGAGCGGGACACGATGGTGGAGGAATACTGCTCCCGGACTGCCAGTATCA
CCGGAGACTGGAAGTACACGGATGAATATCGTGAGGTGACGATACCGCACTCACAGTTCCGGTTCAGTAT
GAACGGTCTGAAACTGGTGTTCAGCGTTACCGTACCTGTTGCCGGGACAGTGGAAAGTGCCTCGCTATCG
GTTCATGCAGGGCTATATTTCCTTAACTCCCGTTACGACTTTATGAACACAACCTTTAATGTGCAACTGG
TTACAGGACAGAGCGGGACTTTCACCATACCTGTGCCCTCCGGGTTTTCTGTCACACAGGGGCAGGTTCT
GACCGGTAGTGGCTGTACTGCAAACGGTAATTGCCTCCCGCACGGGAATGGTGACAGGAAAGTCTATGAA
TCGCTTGTCAGTGGTGCTTCCACCTTTACGCTGAAACTCAGGATGAAGGTCCGTGATAAAGAATGGGTTC
CCCGGGTGGAGTGGGTGGAGAGTTGTCCGTTTAATAAAGCGGATGGCGTGCTGAAAGGCACTGAGTGTTC
AGAGCCGGGTGGTACGAAAACGGGTGTGATGGAAGGTAAACCCTGGAGCATCACACAGGCATGCTGGGCA
TACCGGGATAAATATGTCACTCAGTCCGCAGATAACGGCACCTGTCAGAAATATGTCGATAATCCGGCCT
GTACGCTGGCCTCACGTCAGTGCGCGTTTTATTCCGATGAGGGAACCTGTCTGCATGAGTACGCCACGTA
CTCCTGCGAGTCAAAAACATCAGGAAAAGTGATGGTCTGTGGTGGTGATGTCTTCTGCCTTGACGGTGAA
TGCGATAAGGCACAGAGCGGAAAAAGCAGTGATTTTGGTGAAGCAGTATCACAGCTGGCTGCGCTTGCCG
CCGCAGGTAAGGATGTTGCCGCCCTGAATGGTGTGGATGTCAGGGCTTTCACGGGTGAGGCGAAATTCTG
CCGTAAGGCCGCAGCCGGCTTCAGTAACTGCTGTAAGGATGGCGGCTGGGGTCAGGATGTGGGGCTGGCG
AAGTGCAACAGTGAAGAAAAGGCGCTGGGAAAGGCAAAGGACAATAAACTGACGGTGAGTGTGGGTGAGT
TCTGTTCGAAAAAGGTGCTGGGGGTCTGCCTGCAGAAAAAGCGCAGCTACTGCCAGTTTGATTCGAAGCT
GGCGCAGATAGTCCAGCAGCAGGGGCGTAACGGGCAGTTGCGTATCGGGTTTGGCAGTGCGAAGCATCCT
GACTGTCGGGGGATTACGGTTGATGAGCTGCAGAAAATTCAGTTCGACAGACTGGATTTCACTAACTTCT
ACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGCGTTCTGACGCAGAAAGTGAAAGAGCAGAT
TGCTGACCAGCTGAAACAGGCAGGACAGTAA
 Primer design