SecReT4
Protein ID: 291289312
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_118
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]91192..91788 [-]
ProductTrbC
Component typeTrbC_F
UniProt IDD4HR02
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 4.2e-28, Aligned region: 80..177
Protein Sequence: 198 a.a.     [Download]
>gi|291289312|ref|YP_003517644.1| TrbC [Klebsiella pneumoniae]
MHLAVHASENVNTTENRQFLKQQETLSQQLREKPDIQLQAWAEQQVRANPLQHSDNQFLDELVRKQQAAQ
KDKPQQGAVYFVSFSIPEEGLKRMLGETRHYGIPATLRGMVNNDLKTTAEAVLSLVKDGATDGVQIDPTL
FSQYGIRSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDSGK
 
Nucleotide Sequence: 597 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c91788-91192 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGCATCTTGCTGTTCATGCTTCAGAAAATGTGAACACAACTGAAAACCGCCAGTTCCTGAAGCAGCAGG
AAACACTGAGTCAGCAGTTACGTGAAAAGCCGGACATACAGTTGCAGGCATGGGCAGAGCAGCAGGTCAG
GGCGAATCCCCTTCAGCATTCCGATAACCAGTTTCTCGATGAACTGGTCCGTAAACAGCAGGCTGCTCAG
AAGGATAAACCACAGCAGGGCGCCGTGTACTTTGTGTCCTTCTCCATTCCCGAAGAGGGGCTGAAACGGA
TGCTGGGCGAAACCCGGCACTACGGTATTCCGGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGAC
CACCGCTGAAGCCGTGTTGTCCCTGGTGAAAGACGGCGCAACTGATGGTGTTCAGATCGACCCGACGCTG
TTTTCACAGTACGGCATTCGCAGCGTACCGGCACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCC
GGGGAAATCTGCGGGTCGGCCAGGCGCTGGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCA
TGATTTACTGGCAGGGAAAGGAGATTCCGGGAAATGA
 Primer design