SecReT4
Protein ID: 291289314
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_120
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]92174..93166 [-]
ProductTraU
Component typeTraU_F
UniProt IDD4HR04
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.4e-84, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|291289314|ref|YP_003517646.1| TraU [Klebsiella pneumoniae]
MKRRLWLLMLFLLAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVPDTANPSMPIQIC
PAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYP
LTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVMRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c93166-92174 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGAAGCGAAGACTGTGGCTGCTGATGTTATTCCTTCTCGCCGGTCATGTCCCTGCGGCGTCTGCGGATT
CTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACGGATATCTGCTGGAGCTGTATTTTCCCGCTCTCGCT
GGGCAGTATCAAAGTCAGCCAGGGTAAGGTCCCCGACACGGCGAACCCGTCGATGCCTATTCAGATTTGT
CCGGCACCGCCGCCGCTGTTCAGGCGTATCGGGCTGGCCATTGGTTACTGGGAGCCGATGGCGCTGACGG
ACGTCACCCGGTCACCGGGATGCATGGTGAACCTGGGCTTCAGCCTGCCGGCTTTTGGTAAAACGGCACA
GGGAACGGCGAAAAAGGATGAGAAGCAGGTGAACGGGGCGTTCTATCACGTTCACTGGTACAAATACCCG
CTGACGTACTGGCTGAACATCATCACATCGCTGGGTTGTCTGGAAGGTGGTGACCTGGATATCGCTTATC
TTTCTGAAATCGACCCCACCTGGACGGACAGCAGCCTGACCACCATTCTCAACCCGGAAGCCGTCATTTT
TGCCAATCCGATAGCACAGGGGGCCTGCGCAGCAGATGCCATTGCCAGTGCCTTTAATATGCCTCTCGAT
GTTCTGTTCTGGTGTGCCGGTTCGCAGGGCAGTATGTACCCGTTCAATGGCTGGGTGAGTAATGAGTCCA
GTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATGGCATTCAAGCTGCACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAATATCCGTCCCCAATCCTGCCCAAAGAACGCTGG
CGTTATCAGATGGTGAATATGTATCCGGACAGCGGACAGTGCCATCCGTTCGGGCGCAGTGTGATGCGCT
GGGAGACGGGAAAAAATCCGCCCAACACAAAGAAAAACTTCGGCTACCTGATGTGGCGTAAACGTAACTG
TGTATTCCTGTAA
 Primer design