SecReT4
Protein ID: 291289315
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_121
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]93163..93909 [-]
ProductTraW
Component typeTraW_F
UniProt IDD4HR05
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 9.6e-11, Aligned region: 39..68
Protein Sequence: 248 a.a.     [Download]
>gi|291289315|ref|YP_003517647.1| TraW [Klebsiella pneumoniae]
MAAETPRGHSGVACRGTGGSGYHPGNPAGYCPANESGTMRCRGLIALLIWGQSVAAADLGTWGDLWPVKE
PDMLTVIMQRLTALEQSGEMGRKMDAFKERVIRNSLRPPAVPGIGRTEKYSSRLFDPSVRLAADIRDNEG
RVFARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEMQKALDSRIYFDQ
NGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK
 
Nucleotide Sequence: 747 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c93909-93163 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
GTGGCAGCAGAAACACCACGCGGTCATTCTGGTGTCGCCTGCCGTGGTACAGGGGGCTCCGGATATCACC
CGGGAAATCCAGCAGGATATTGCCCGGCGAATGAGAGCGGAACCATGAGATGCCGGGGGCTGATTGCCCT
GCTGATATGGGGGCAGAGTGTGGCCGCCGCCGATCTTGGCACCTGGGGCGATCTGTGGCCGGTAAAGGAG
CCGGACATGCTGACGGTGATCATGCAGCGCCTGACGGCACTGGAGCAGTCCGGTGAGATGGGCCGGAAAA
TGGATGCCTTTAAGGAGCGGGTGATCCGTAACAGTCTGCGGCCCCCTGCCGTGCCCGGTATCGGACGCAC
GGAGAAATACAGCAGCCGGTTGTTTGACCCGTCCGTCAGACTGGCTGCGGATATCCGGGATAACGAAGGG
CGGGTGTTTGCCCGTCAGGGTGAAGTGATGAATCCGCTGCAGTATGTTCCTTTTAACCAGACGCTGTATT
TCATCAATGGCGATGATCCGGCGCAGGTGGCCTGGATGAAACGCCAGACGCCGCCCACACTGGAGAGCAA
AATTATCCTCGTGCAGGGCAGTATCCCGGAGATGCAGAAAGCGCTGGACAGCCGTATTTACTTTGACCAG
AACGGTGTGCTCTGCCAGCGCCTCGGCATTGATCAGGTCCCGGCACGGGTGAGCGCCGTTCCCGGCGATC
GCTTCCTGAAGGTGGAATTTATTCCGGCAGAGGAGGGCAGAAAATGA
 Primer design