SecReT4
Protein ID: 291289317
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_123
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]94175..96202 [-]
ProductTraC
Component typeTraC_F
UniProt IDD4HR07
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.3e-43, Aligned region: 279..572
TraC_F_IV [PF11130], Evalue: 3e-07, Aligned region: 9..77
DUF87 [PF01935], Evalue: 2e-05, Aligned region: 282..469
TrwB_AAD_bind [PF10412], Evalue: 3.8e-05, Aligned region: 279..317
Protein Sequence: 675 a.a.     [Download]
>gi|291289317|ref|YP_003517649.1| TraC [Klebsiella pneumoniae]
MHRPLSILYGEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFH
LARNPEIAFLWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPS
VEKEAKEWGELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFL
TCLPFMAGKGLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNY
NMAVCGTSGAGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQS
AERVRDQLSVMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLD
EMIVLLDQYTANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLK
KLNVIDEGWRLLDFKNYKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILK
QSAKEFAKYNQLYPDQFQPLQRDMIGKFGAARDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFE
FVQQKRKEGLSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2028 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c96202-94175 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGCACAGGCCTTTATCGATATTGTACGGGGAGATGATTAATCATAACCCGGACTCCCTGTACCCGAAAA
GACGTCAGCTGGACCCGTATTCTGATCTGAATTATCAGTGTGTGGAGGACAGTTTTGACCTGAAAGTCCG
GGCTGATTACCTGACGCTGGGCCTGCGTGAGAACGGCAGGAACAGCACGGCCCGCATCCTGAATTTCCAT
CTGGCCCGTAACCCGGAAATCGCCTTCCTGTGGAATATGGCCGACAACTACAGCAACCTGCTGAACCCGG
AACTGTCCATCTCCTGTCCGTTCATCCTGACGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACCCACAG
CGAAGCCAACCTGAAGTACATGGACCTGGAGAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCC
GTGGAGAAAGAGGCGAAGGAGTGGGGGGAACTGCGTCAGCGGCTGGGCTCCGGTCAGTCTTCTGTCGTGT
CCTACTTCCTCAACATCACAGCCTTCTGCAAGGACAATAATGAAACGGCACTGGAAGTGGAGCAGGACAT
CCTGAACAGCTTCCGTAAAAACGGTTTTGAGCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTG
ACCTGCCTGCCCTTTATGGCCGGGAAAGGGCTGTTTAAACAGCTGAAAGAGGCCGGTGTGGTTCAGCGCG
CAGAGAGCTTTAATGTTGCCAACCTGATGCCGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCT
GGCACCCACCTACCGTAACCAGCTGGCGTTTATCGATATTTTCTTCCGGGGGATGAATAACACCAACTAC
AACATGGCGGTCTGTGGCACCTCCGGGGCCGGTAAAACCGGACTGATACAGCCCCTTATCCGCAGCGTGC
TGGACTCCGGGGGCTTTGCCGTGGTGTTCGACATGGGGGATGGCTACAAGTCCCTGTGTGAGAACATGGG
TGGCGTATATCTGGACGGTGAAACCCTGCGTTTTAACCCGTTTGCGAATATCACCGATATCGACCAGTCA
GCGGAGCGTGTCCGTGACCAGTTGTCAGTGATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAG
GTCTGCTGCTGCAGGCGGTCAGGGCCTCCTGGCTGGCCAAAGAGAACAGGGCACGTATTGATGACGTGGT
GGATTTCCTGAAAAACGCCAGTGACAGCGAGCAGTATGCCGGGTCACCGACTATCCGCAGCCGTCTGGAC
GAAATGATTGTGCTGCTTGACCAGTACACTGCCAACGGCACTTACGGTCAGTATTTTAACTCTGATGAGC
CGTCCCTGCGGGATGACGCAAAAATGGTGGTGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCACTGCT
GGTTGCGGTGATGTTCTCCCTGATTATCTACATCGAGAACAGGATGTACCGCACGCCGCGTAACCTCAAG
AAACTGAACGTCATTGATGAAGGCTGGCGTCTGCTGGACTTCAAAAATTACAAGGTCGGTGAGTTTATTG
AGAAAGGTTACCGTACCGCCCGTCGTCATACCGGTGCTTATATCACCATCACACAGAACATCGTCGACTT
TGACTCTGACAAGGCCTCCAGTGCGGCCCGTGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAA
CAGAGTGCGAAGGAGTTCGCAAAATACAACCAGCTGTATCCGGACCAGTTCCAGCCACTGCAGCGCGACA
TGATTGGTAAGTTTGGTGCGGCCAGAGACCAGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTC
CTCCTGGCACCGCCTGTTTGTGGACCCGTTAAGTCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAG
TTTGTGCAGCAGAAACGTAAAGAGGGGCTGAGTATTCATGAGGCGGTGTGGCAGCTGGCGTGGAAGAAGT
CAGGGCCGGAGATGGCTTCGCTGGAAGCCTGGCTGGAAGAACATGAGAAATACAGGAGTGTTGCATGA
 Primer design