SecReT4
Protein ID: 291289318
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_124
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]96162..96803 [-]
Producttype IV secretory pathway VirB4 component
Component typeTraC_F
UniProt IDD4HR08
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.1e-44, Aligned region: 37..210
Protein Sequence: 213 a.a.     [Download]
>gi|291289318|ref|YP_003517650.1| type IV secretory pathway VirB4 component [Klebsiella pneumoniae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLKSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIVR
GDD
 
Nucleotide Sequence: 642 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c96803-96162 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
GTGAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGCCTGACG
AATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTACCG
TGATTACAACCAGGAGTCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATTCCC
ATCAATGGGGCGAATGAGTCCATTGTGGAGGCGCTCGACCACATGCTGCGCACCAAACTGCCACGCGGAG
TGCCGTTCTGCATCCATCTGAAGTCCAGCCAGCTTGTTGGTGACAGAATTGAATACGGGCTGCGTGAGTT
CTCCTGGTCCGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGTGCCTATTATATGAACGCGGCAGCG
ACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTATTCTTCTCGT
ACTGTTCTCCCTCGAAGAAAAAAAGCCGGGCTGACATTCTGGAAATGGAAAACCTGGTGAAAATCATCCG
GGCGTCGTTACAGGGGGCCAGTATCGCCACACAGACGGTGGATGCACAGGCCTTTATCGATATTGTACGG
GGAGATGATTAA
 Primer design