SecReT4
Protein ID: 291289321
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_127
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]97319..97834 [-]
ProductTraV
Component typeTraV_F
UniProt IDD4HR11
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 3.2e-39, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|291289321|ref|YP_003517653.1| TraV [Klebsiella pneumoniae]
MKQISLFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANEKAKELEQSSEAKPVAASLPRLAEGNF
RTMPVQTVTATPPSGSRPAVTALPEQKLLAPRPLFTAAREVKTIVPVSSVAPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c97834-97319 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGAAACAGATTTCTTTATTTATTCCTCTGCTGGGAACGTTATTACTTTCCGGCTGTGCCGGAACCAGTA
CGGAATTTGAGTGTAACGCCACCACATCCGATACCTGTATGACGATGGAGCAGGCCAATGAGAAGGCCAA
AGAACTGGAGCAGTCCTCAGAAGCAAAGCCGGTTGCGGCATCACTGCCGCGCCTGGCTGAAGGGAACTTC
CGGACAATGCCGGTGCAGACCGTCACCGCGACCCCTCCGTCCGGCAGCAGACCTGCGGTGACGGCACTTC
CGGAGCAGAAACTGCTGGCACCACGTCCGTTGTTTACGGCTGCCCGGGAAGTGAAAACGATTGTTCCGGT
CAGTTCAGTTGCGCCGGTAACACCTCCCCGCCCGCTAAGAACGGGTGAGCAGACGGCTGCATTATGGATA
GCGCCTTATATTGATAATCAGGATGTTTATCATCAGCCATCCAGTGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGGAAAACCACGTATTAATTAA
 Primer design