SecReT4
Protein ID: 291289324
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_130
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]98688..100139 [-]
ProductTraB
Component typeTraB_F
UniProt IDD4HR14
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3e-40, Aligned region: 213..409
CALCOCO1 [PF07888], Evalue: 4.7e-05, Aligned region: 68..121
Protein Sequence: 483 a.a.     [Download]
>gi|291289324|ref|YP_003517656.1| TraB [Klebsiella pneumoniae]
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVVDTTFDDKVRQHA
TTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQTPA
SPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVMYQSVPVPNRIQRKVFTRNEGKQGPS
LPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAI
VRTRNISCLKNGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLG
ATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALEQS
QSTAEEGNPESPVPNPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGDKNPQGGDAGKEGGNGG
 
Nucleotide Sequence: 1452 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c100139-98688 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGGCCAGTATCAACACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTACAG
CCTCCGCGATTGGTGGGGCACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGGGAAACCGTGGCTGA
ACAGGAGCCTGTGCCGGATATGACCGGTGTGGTGGATACGACCTTTGATGACAAGGTGCGTCAGCATGCC
ACCACAGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAACTGGATG
TCCTGAACAAACAGCGCGGTGATGACCAGCGTCGTATTGAAAAACTGGGACAGGACAATGCCGCCCTGGC
AGAGCAGGTAAAAGCCCTGGGTGCTAATCCCGTCACGGCGACCGGTGAGCCTGTACCGCAGACGCCAGCC
TCACCGCCCGGGCCGGAAGGCGAACCACAGCCGGGAAACACCCCCGTATCCTTCCCGCCGCAGGGCAGCG
TTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGGAATGGTGTCACGCCACCACCACAGGTGATGTACCA
GTCTGTGCCGGTGCCTAACCGGATACAGCGTAAGGTGTTTACCCGTAATGAGGGAAAACAGGGACCATCG
CTGCCGTACATTCCGTCAGGAAGTTTTGCGAAAGCCATGCTGATTGAAGGGGCGGATGCCAATGCCTCAG
TCACCGGTAATGAATCCACGGTGCCGATGCAGCTGCGTATCACCGGTCTGGTGGAAATGCCGAACAGCAA
GACGTATGACGCAACGGGATGTTTTGTGGGGCTGGAAGCCTGGGGGGATGTCTCCAGTGAACGTGCTATT
GTTCGCACCCGTAATATCAGCTGCCTGAAGAATGGCAAAACCATTGATATGCCGATTAAGGGGCATGTCA
GCTTCCGGGGTAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGCAAAATCCTCGGCTGGGCATG
GGGCGCGGGATTTGTTGACGGTATCGGTCAGGGAATGGAGCGCGCCTCCCAGCCGGCTGTCGGGCTGGGT
GCCACAGCCGCTTACGGGGCCGGCGATGTCCTTAAAATGGGTATCGGTGGCGGCGCATCGAAAGCCGCAC
AGACGCTCAGTGACTACTACATCAAACGTGCCGAACAGTATCACCCGGTGATACCGATTGGTGCGGGCAA
CGAAGTGACAGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACCGTGGAGGAAATGGCGCTGGAGCAGTCA
CAGAGTACAGCGGAAGAGGGTAACCCGGAAAGCCCTGTGCCGAATCCTCCCTCGGCAGAAAGCCACCTGA
ACGGTTTTAACACCGACCAGATGCTGAAGCAGCTGGGCAATCTGAATCCGCAGCAGTTTATGTCCGGAGA
CAAGAACCCGCAGGGCGGGGATGCCGGCAAGGAGGGCGGAAATGGCGGGTGA
 Primer design