SecReT4
Protein ID: 291289325
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_131
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]100139..100867 [-]
ProductTraK
Component typeTraK_F
UniProt IDD4HR15
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 7.5e-69, Aligned region: 12..235
Protein Sequence: 242 a.a.     [Download]
>gi|291289325|ref|YP_003517657.1| TraK [Klebsiella pneumoniae]
MRKNNTAIIFGSLFFSCSVMAANGTLSPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADAVWTGNHLKMVRFAVENKTLSALNIRESDFWQ
PGTRAVMFSQPASQLLAGACMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c100867-100139 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGAGAAAAAATAATACGGCAATAATATTCGGCAGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGTCCCCCACCGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGTCTGGATGGTGCCCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTTGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAACGTGGTCTGAATCTTTCCATTCAGGCCGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGTGCGTGGGAAACGTCCACGCCTTACGAATCCCTG
CTTGTGACCATCAGCCAGGCTGTCCGTGGCGGAAAATTACCTGCAGGCTGGTATCAGGTTCCTGTGACAA
AGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATGCCGTATGGACGGGGAATCACCTGAA
GATGGTCCGCTTTGCCGTGGAAAATAAAACGCTGTCTGCCCTGAATATCCGGGAAAGTGACTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGGCAGGTGCGTGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design