SecReT4
Protein ID: 291289326
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_132
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]100854..101420 [-]
ProductTraE
Component typeTraE_F
UniProt IDD4HR16
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 6.2e-74, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|291289326|ref|YP_003517658.1| TraE [Klebsiella pneumoniae]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGVNNYRLQNEQRTAVTPMAFNAPFAVSQNSADASYL
QQMALSFIALRLNVSSETVDASHQALLKYIRPGAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYG
RVEIRGVLKTWIGDSKPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c101420-100854 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACGTCATTCAGGGGGTGAATAACTACCGTCTTCAGAATGAGCAACGCAC
TGCCGTGACGCCAATGGCATTTAATGCCCCCTTTGCCGTGTCACAGAACAGTGCCGACGCCTCTTATTTA
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTTTCATCAGAAACCGTCGATGCCTCACATC
AGGCGCTTCTGAAATATATCCGCCCGGGCGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
GCGTATTAAAAACGATAACGTGAACTCAGCCTTTTTCCAGACCAGTGTTCGTGTCTGGCCTCAGTATGGC
CGTGTGGAAATTCGTGGTGTGCTTAAAACCTGGATTGGTGATTCAAAACCTTTCACTGATATCAAACATT
ACATCCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA
 Primer design