SecReT4
Protein ID: 291289327
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_133
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]101759..102121 [-]
ProductTraA
Component typeTraA_F
UniProt IDD4HR17
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 1.9e-60, Aligned region: 1..118
Protein Sequence: 120 a.a.     [Download]
>gi|291289327|ref|YP_003517659.1| TraA [Klebsiella pneumoniae]
MDAFLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAQGQDLMASGNTTVKATFG
KDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGLK
 
Nucleotide Sequence: 363 bp     [Download]
>gi|291289198|ref|NC_013951.1|:c102121-101759 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGGACGCCTTTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTCAAAAAGAAATCGTTTTTTTCTAAATTCA
CTCGTCTGAATATGCTTCGCCTGGCTCGCGCTGTGATCCCTGCTGCTGTTCTGATGATGTTCTTCCCGCA
ACTGGCAATGGCAGCACAGGGCCAGGACCTGATGGCAAGCGGTAACACCACGGTTAAGGCGACCTTCGGT
AAGGACTCCAGTGTTGTTAAATGGGTTGTTCTGGCTGAAGTTCTGGTCGGTGCGGTCATGTACATGATGA
CCAAAAACGTCAAGTTCCTGGCCGGTTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGGCCGTCGT
TGGCCTGAAATAA
 Primer design