SecReT4
Protein ID: 291289329
T4SS name [ID]Tra_F [129]
Gene symbol-
Locus tagpKF140_135
StrainKlebsiella pneumoniae plasmid pKF3-140 (NC_013951)
Repliconplasmid pKF3-140 [GenBank: NC_013951] [Browse all T4SS(s) in this replicon]
Location [Strand]103208..103624 [+]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDD4HR19
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 138 a.a.     [Download]
>gi|291289329|ref|YP_003517661.1| lytic transglycosylase [Klebsiella pneumoniae]
MRLIVIKLNQIKILLFEANQLLILFNPGYGSGLMQVDSQHFNELARYGIKPEHLTTDPCMNIYTGAYYLA
IAFKKWGVTWEAVGAYNAGFRKTVRQNQRRLAYASDVYRIYTGIKSSKGIRLPATKKSLPEINSVQNN
 
Nucleotide Sequence: 417 bp     [Download]
>gi|291289198|ref|NC_013951.1|:103208-103624 Klebsiella pneumoniae plasmid pKF3-140, complete sequence
ATGCGGTTAATTGTCATCAAATTGAACCAGATCAAAATCCTGTTATTTGAAGCAAATCAACTTTTAATTC
TTTTTAACCCGGGATATGGCAGCGGACTGATGCAGGTAGATTCCCAGCATTTTAACGAACTGGCCCGCTA
CGGAATTAAGCCAGAACATCTGACAACAGATCCCTGCATGAACATTTATACCGGTGCTTATTATCTGGCA
ATAGCATTTAAAAAATGGGGCGTCACCTGGGAGGCCGTTGGTGCATACAATGCCGGATTCAGGAAAACCG
TACGCCAGAACCAGAGACGTCTTGCCTACGCATCAGATGTTTACCGGATTTATACCGGGATAAAAAGCAG
TAAAGGTATCCGGCTTCCGGCCACGAAGAAATCACTTCCGGAAATTAACAGCGTGCAGAACAATTAA
 Primer design