SecReT4
Protein ID: 29144513
T4SS name [ID]Tfc [743]
Gene symbol-
Locus tagt4257
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T4SS(s) in this replicon]
Location [Strand]4425085..4425636 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ8Z1K5
KEGG IDstt:t4257, sty:STY4559
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 183 a.a.     [Download]
>gi|29144513|ref|NP_807855.1| hypothetical protein t4257 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MATEVGVPAEALYSVSLAETSRKLPHGERPWPWTLNVAGKGYRYNSRQEAYDAMLSFMRRYPLKRIDVGI
AQVNLGWNGTYFSSYYEALDPYTNLRVAARILKSCYDNNPGSWIQAAGCYHHPAGGKPARIYKSIVKRKL
ATLDLNAPVTYSELQIAQISPSQRHFSHYNRELQWVEPRESRQ
 
Nucleotide Sequence: 552 bp     [Download]
>gi|29140543|ref|NC_004631.1|:4425085-4425636 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
GTGGCAACTGAAGTCGGCGTACCCGCTGAAGCCCTGTATTCAGTTTCTCTTGCAGAAACATCCCGAAAAC
TACCACATGGAGAGCGACCGTGGCCGTGGACACTCAATGTTGCCGGGAAAGGGTATCGGTATAACTCCCG
CCAGGAAGCGTATGACGCAATGTTGTCGTTCATGCGTCGCTATCCGTTAAAGCGGATTGATGTTGGGATC
GCGCAGGTTAACCTGGGCTGGAATGGAACTTATTTCAGCAGTTACTACGAAGCGCTGGATCCATATACCA
ACCTTCGGGTTGCCGCCCGTATTCTTAAATCCTGTTATGACAACAATCCGGGAAGCTGGATACAGGCCGC
GGGGTGTTATCACCATCCTGCAGGTGGAAAACCAGCACGAATCTATAAGTCCATCGTGAAACGCAAGCTG
GCAACACTGGATTTAAACGCGCCAGTAACGTACTCCGAACTTCAGATCGCACAGATATCGCCATCACAGC
GCCATTTCTCACACTACAACCGTGAATTGCAATGGGTTGAACCCAGGGAGTCCCGTCAGTGA
 Primer design