SecReT4
Protein ID: 29144517
T4SS name [ID]Tfc [743]
Gene symbol-
Locus tagt4261
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T4SS(s) in this replicon]
Location [Strand]4428858..4429616 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ8Z1K1
KEGG IDstt:t4261, sty:STY4563
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5.8e-70, Aligned region: 50..249
Protein Sequence: 252 a.a.     [Download]
>gi|29144517|ref|NP_807859.1| hypothetical protein t4261 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MSTEKNSSQSSPPPRKPPGLLTLVLWIWPVRLLAFLLVSWMAGVFIEWAGMFFFWSDQGALHSQSVMNKE
LGYLSADFTQSLIFSSPSVTTMGWISSAYQWAFVDSGLLTWIQKEQRETLSSSDSVVFFLGQVQAWLLSV
LSDYLLALVYVTVVFAVRVLILVLSIPLFVLVIIVAVIDGLCRRDLRRYGAGYESSFLYHHAKRFVKPAV
YLPCLLYLSWPASIYPNLLLLPGALLLGLAVTVVTSTFKKYL
 
Nucleotide Sequence: 759 bp     [Download]
>gi|29140543|ref|NC_004631.1|:4428858-4429616 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGAGTACAGAAAAAAACAGCTCTCAAAGTTCTCCACCACCGCGCAAGCCACCAGGTTTGCTGACCCTTG
TTTTGTGGATCTGGCCAGTCAGGCTTTTGGCTTTTCTGCTGGTATCCTGGATGGCTGGTGTTTTTATTGA
ATGGGCAGGAATGTTTTTTTTCTGGTCAGATCAGGGAGCTTTGCATTCCCAGTCCGTTATGAATAAAGAA
CTTGGCTATTTATCAGCAGATTTTACTCAAAGCCTTATTTTTTCTTCACCATCAGTAACTACGATGGGCT
GGATTTCGTCAGCTTACCAATGGGCATTTGTGGACAGTGGATTACTCACCTGGATTCAGAAAGAACAAAG
GGAGACATTAAGCAGTTCTGACTCTGTTGTTTTTTTTCTGGGACAAGTGCAGGCCTGGTTATTATCAGTG
TTAAGCGATTATCTGCTTGCGCTGGTTTATGTCACCGTCGTTTTTGCCGTCAGGGTATTAATTCTTGTTT
TATCCATCCCGTTATTTGTTCTGGTTATCATCGTCGCTGTTATAGACGGGTTGTGTCGTCGTGACCTGAG
ACGTTACGGGGCGGGTTATGAGTCGAGTTTTCTGTATCACCATGCCAAACGGTTTGTTAAACCGGCTGTT
TATCTCCCTTGCTTACTTTACTTGTCATGGCCTGCGTCGATTTATCCAAATCTGTTACTTCTGCCCGGGG
CATTGTTACTGGGACTGGCGGTTACTGTAGTGACATCTACATTCAAAAAATATCTGTGA
 Primer design