SecReT4
Protein ID: 29144518
T4SS name [ID]Tfc [743]
Gene symbol-
Locus tagt4262
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T4SS(s) in this replicon]
Location [Strand]4429835..4430107 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ8Z1K0
KEGG IDstt:t4262, sty:STY4564
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.5e-30, Aligned region: 9..85
Protein Sequence: 90 a.a.     [Download]
>gi|29144518|ref|NP_807860.1| hypothetical protein t4262 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MFSLPEMVSAAEKDELALALRQLDQVQSALERAKIVAVQDNSDGRFFFDYERATRDLKTMKQGIETYLEP
SRAQPRDKGSLVGQYRKEQP
 
Nucleotide Sequence: 273 bp     [Download]
>gi|29140543|ref|NC_004631.1|:4429835-4430107 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
TTGTTCTCTCTGCCAGAGATGGTCAGTGCAGCTGAAAAGGATGAACTGGCCCTCGCTCTCAGGCAGCTGG
ACCAGGTCCAGTCTGCGCTTGAACGCGCGAAAATTGTAGCGGTACAGGACAATTCTGACGGGCGTTTCTT
CTTCGACTATGAGCGGGCAACACGTGATTTGAAAACCATGAAGCAGGGGATTGAAACTTATCTGGAGCCT
TCCCGGGCACAGCCAAGAGACAAAGGTTCTCTTGTTGGACAATACAGGAAGGAGCAGCCCTGA
 Primer design