SecReT4
Protein ID: 29144523
T4SS name [ID]Tfc [743]
Gene symbol-
Locus tagt4268
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T4SS(s) in this replicon]
Location [Strand]4432661..4434139 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDQ83ST0
KEGG IDstt:t4268
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 492 a.a.     [Download]
>gi|29144523|ref|NP_807865.1| hypothetical protein t4268 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MQIKANGLMKVLLPVLIVVVCFIGVKACGLKDTTEPEPAKTTNALTELSQDDLKALGIEGDTSADTLRTL
IGALRDVRARQAVLDEQNKALISENNKLKGENSSVGLQISNAVNAAKQETNEALEKQKTFLLEKLNDLTG
TLKSQGQNTDMVSTGSSSGTDFPVGLGLDPENASSATQGEVIWISPQDAKKTEGQSQSDNDKFTFPTSFL
DDNPVSRQRAEYDRVVKNKQELDGNGAESDTRPVYTLPENSTLVGSKAMTALIGRIPINDKVTDPYPFKV
LIGKDNLTANGIELPDVEGAIVSGTATGDMVLSCVRGTIHSITFVFSDGRIRTLPRPVANTQGNNNDNAG
DRGSIGWISDNNGIPCISGERKSNASTYLPTVALLGMGSSAGDALTQNQYTTQNNVNGGVTSALTGNAGQ
AVLGQTLGGGFKEVTDWVKQRYGQTFDAVYVPPGANVAIHITRQLAVDYEDHGRKVRYDFSLPGTGGHYG
LD
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|29140543|ref|NC_004631.1|:4432661-4434139 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGCAAATTAAAGCCAATGGCCTGATGAAGGTTTTACTTCCAGTATTGATCGTGGTGGTTTGTTTTATTG
GCGTTAAAGCCTGTGGTTTAAAAGATACTACTGAACCTGAACCCGCTAAAACCACTAATGCATTGACTGA
GTTGAGCCAGGATGATTTGAAAGCACTGGGTATTGAGGGGGATACGTCAGCAGACACGCTACGTACACTT
ATTGGAGCGTTGCGTGATGTCCGGGCCCGCCAGGCTGTGCTGGATGAGCAAAATAAGGCACTCATTTCTG
AAAATAATAAGCTCAAGGGTGAGAATTCATCGGTAGGACTCCAGATATCAAATGCTGTAAATGCCGCAAA
ACAGGAAACGAACGAGGCTCTTGAAAAACAGAAAACGTTCCTACTGGAGAAGCTCAATGACCTGACCGGA
ACACTGAAATCCCAGGGACAAAACACTGACATGGTGTCGACAGGTTCGTCTTCAGGAACCGATTTCCCGG
TTGGCCTTGGACTGGATCCAGAGAATGCATCCTCTGCAACTCAGGGGGAGGTGATCTGGATATCTCCTCA
GGATGCTAAAAAGACAGAGGGTCAAAGCCAGAGTGATAATGATAAATTCACCTTTCCCACCTCTTTTCTG
GATGATAACCCCGTCAGTCGTCAGCGAGCTGAGTACGATCGCGTTGTTAAAAACAAGCAGGAACTGGACG
GAAACGGTGCAGAGTCCGATACACGGCCTGTTTATACGTTGCCTGAGAACTCAACCCTGGTAGGCAGTAA
GGCGATGACGGCATTAATTGGTCGTATACCAATTAATGACAAAGTCACCGATCCTTATCCATTTAAAGTC
CTGATCGGTAAGGATAACCTAACTGCAAACGGTATCGAATTGCCCGATGTTGAGGGGGCTATTGTTTCCG
GGACTGCTACAGGGGATATGGTGCTTTCGTGTGTCAGAGGAACGATACATTCGATCACGTTTGTTTTTTC
CGATGGACGTATAAGAACACTTCCCAGACCCGTAGCAAACACTCAGGGCAACAATAATGACAACGCCGGA
GACAGGGGCAGCATTGGCTGGATATCAGATAACAACGGAATTCCCTGTATCAGTGGTGAGCGCAAATCTA
ATGCTTCAACTTATCTGCCAACGGTTGCGTTACTGGGGATGGGAAGCTCCGCAGGTGATGCGTTAACACA
AAATCAATATACCACTCAGAACAATGTGAATGGTGGGGTGACATCAGCCTTAACCGGCAATGCGGGGCAG
GCGGTACTGGGGCAGACGCTGGGAGGGGGATTTAAAGAAGTTACCGACTGGGTTAAACAACGTTACGGAC
AGACGTTTGATGCGGTGTATGTCCCACCTGGTGCAAATGTCGCTATTCATATTACTCGTCAACTGGCCGT
TGATTATGAAGACCATGGTCGTAAGGTTCGATATGACTTCAGCTTGCCCGGAACAGGAGGCCATTATGGT
CTTGACTGA
 Primer design