SecReT4
Protein ID: 29144530
T4SS name [ID]Tfc [743]
Gene symbol-
Locus tagt4274
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T4SS(s) in this replicon]
Location [Strand]4439479..4440909 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ8Z1I8
KEGG IDstt:t4274, sty:STY4577
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|29144530|ref|NP_807872.1| hypothetical protein t4274 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MRSQSILSVCLMLGIVSSGPLSAALLDAPTLSGDGYGKSVNGAVSDKLFYSIGGGSVISTPGTMYGMKRI
GLDAGLSSDLMCGNFDIKTTVGNQLNGVTNGFKDLMGDVITGATGAVSSMPAMILQRANPGLYEMITNGV
LQAGLAFDKSKLNCESMANKLADYTLGDKSSWTESAVREEYKEAVSASGGDALRAEEARTKASGKEGATW
VGGKKAGGKGQPAIQPTRDLAKAGYNMMNNLSVTSNSTVSAGSCKGSACQKFKNSEEAAAAVVKVLGDRS
IRTCKDATECGSGGIDNAQGTTIAGTGFAPMLEDTTKENLEQLVKLVNGTEAPTQANLDKIKSGSLKVTR
GVIDALKRDPDAGALVQRLAGELAMSDTIETGLAMRRMLTTGQSEPNAADQPQAMAEADRRIEALDRELN
SLKLEMELRREVAKNTALVVVAREENRSVTNPQKESQTNADTRLSELETRKPGDSQ
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|29140543|ref|NC_004631.1|:4439479-4440909 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGAGATCTCAATCCATTTTATCCGTCTGTCTCATGCTGGGTATCGTCAGTTCGGGACCGTTAAGTGCTG
CATTACTGGATGCCCCCACGTTGAGTGGTGATGGATATGGAAAGTCAGTAAATGGCGCGGTTAGTGACAA
GCTGTTTTACAGCATTGGTGGTGGTTCGGTGATTTCCACTCCCGGGACGATGTACGGAATGAAACGTATC
GGGCTGGATGCCGGACTGAGCAGTGATTTGATGTGTGGCAACTTTGATATAAAGACTACTGTCGGAAACC
AGCTTAATGGCGTCACGAATGGTTTCAAAGATTTGATGGGGGATGTGATCACCGGTGCGACCGGGGCGGT
CTCAAGTATGCCGGCGATGATCCTTCAGCGAGCAAATCCGGGTTTGTATGAAATGATCACCAATGGTGTA
CTTCAGGCAGGTCTGGCTTTTGACAAATCGAAACTGAATTGTGAAAGCATGGCCAACAAGCTGGCTGATT
ACACTTTGGGTGACAAGAGCAGCTGGACAGAATCAGCTGTGAGGGAAGAGTACAAGGAGGCGGTCAGTGC
CAGTGGCGGGGATGCGCTGCGGGCAGAAGAGGCCAGAACCAAAGCTTCAGGTAAGGAGGGCGCTACCTGG
GTAGGCGGGAAGAAAGCCGGAGGGAAAGGCCAGCCTGCCATTCAGCCAACGCGTGATCTGGCTAAAGCAG
GATACAACATGATGAATAACCTGAGCGTTACCAGCAACAGCACGGTATCCGCCGGTAGTTGCAAGGGGTC
AGCATGCCAGAAATTTAAAAACTCTGAAGAAGCTGCAGCAGCGGTCGTAAAAGTTCTGGGCGATCGGAGT
ATTCGCACCTGTAAAGATGCCACAGAATGCGGAAGCGGCGGGATTGATAATGCCCAGGGCACGACAATTG
CCGGTACCGGTTTTGCTCCCATGCTTGAGGATACAACCAAAGAGAATCTGGAACAGCTGGTAAAGCTTGT
AAATGGTACTGAGGCTCCGACTCAGGCCAATCTGGATAAAATTAAAAGTGGCAGCCTTAAGGTAACGCGT
GGTGTCATCGATGCCCTGAAACGCGATCCTGATGCCGGTGCGTTGGTTCAGAGACTGGCTGGCGAACTGG
CCATGTCCGACACGATTGAAACCGGTCTGGCGATGCGTCGCATGTTAACGACTGGCCAGTCTGAACCCAA
TGCAGCTGATCAGCCTCAGGCAATGGCTGAAGCCGATCGCCGTATTGAAGCTCTCGATCGTGAGCTTAAC
TCTCTTAAGCTGGAGATGGAACTGCGTCGGGAAGTGGCAAAAAATACCGCGCTGGTTGTGGTTGCGCGCG
AAGAAAATCGTTCGGTCACCAATCCTCAAAAAGAATCGCAGACTAATGCTGATACCCGGCTGAGTGAGCT
TGAAACGCGTAAACCAGGGGACAGCCAATGA
 Primer design