SecReT4
Protein ID: 29171525
T4SS name [ID]Tra_I [174]
Gene symboltraM-2
Locus tagPSPTOA0051
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000A [GenBank: NC_004633] [Browse all T4SS(s) in this replicon]
Location [Strand]52356..53063 [+]
ProducttraM protein
Component typeTraM_I
UniProt IDQ88BM1
KEGG IDpst:PSPTOA0051
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 9.2e-33, Aligned region: 87..192
Protein Sequence: 235 a.a.     [Download]
>gi|29171525|ref|NP_808709.1| traM protein [Pseudomonas syringae pv. tomato str. DC3000]
MTDSSEKLLPVEESLEIPHLPTAEDQHTFEHAMQLQRDRALGAAFAHRCLTAVLWMAPALVLSVSVNGYL
GWQVAHPPVKYFAAEGGRVTKIIPTDKPGHSRRDVSAFGADTIRQSFTLDFVHYRDQMTQLGERYSEVGF
QDYYKALVASNLLKAVKDQRMNLWVDVGPGVIRGSGTIGDKFAWEYQYPVTLKLDGQQSGSPPQRFIFTL
RIQQTDVRVKNAGLEVTQVITTNAN
 
Nucleotide Sequence: 708 bp     [Download]
>gi|29171478|ref|NC_004633.1|:52356-53063 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000A, complete sequence
GTGACTGACTCATCAGAGAAGTTGCTGCCCGTGGAAGAGTCTCTGGAAATACCTCACCTCCCCACGGCGG
AAGATCAGCACACGTTCGAGCATGCCATGCAGTTGCAGCGTGACCGTGCGTTAGGTGCGGCATTCGCCCA
TCGCTGTCTGACCGCAGTGCTCTGGATGGCACCTGCACTGGTGCTATCGGTCAGCGTGAATGGCTACTTG
GGCTGGCAGGTCGCTCATCCTCCGGTGAAGTACTTCGCGGCCGAGGGTGGTCGCGTGACCAAGATCATCC
CTACGGACAAACCAGGGCATAGCAGGCGTGACGTGTCGGCCTTTGGGGCCGACACCATTCGCCAGAGCTT
CACTCTGGACTTCGTGCATTACCGCGATCAGATGACCCAACTGGGCGAACGCTACTCGGAAGTGGGCTTC
CAGGACTATTACAAAGCCTTGGTGGCCTCGAACCTGCTCAAAGCGGTCAAGGATCAGCGCATGAACCTCT
GGGTAGACGTTGGCCCAGGTGTGATTCGCGGTAGCGGGACGATCGGGGACAAGTTTGCCTGGGAGTACCA
GTACCCGGTGACTTTGAAGCTGGATGGTCAGCAATCGGGCAGTCCGCCTCAGCGCTTCATTTTTACTCTG
CGCATTCAGCAGACGGACGTACGCGTGAAAAACGCAGGATTGGAAGTCACGCAAGTGATTACCACCAACG
CTAACTGA
 Primer design