SecReT4
Protein ID: 29171534
T4SS name [ID]Tra_I [174]
Gene symboltraU-2
Locus tagPSPTOA0060
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000A [GenBank: NC_004633] [Browse all T4SS(s) in this replicon]
Location [Strand]58596..61643 [+]
ProducttraU protein
Component typeTraU_I
UniProt IDQ88BL5
KEGG IDpst:PSPTOA0060
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.6e-54, Aligned region: 495..889
Protein Sequence: 1015 a.a.     [Download]
>gi|29171534|ref|NP_808718.1| traU protein [Pseudomonas syringae pv. tomato str. DC3000]
MIRWVEDLITETSRFAVSRDLPDYCDLNTVLRLTDDDRTRHPALNAPYVLVNDDGDYCSVYAVAGSFCDT
DEAAPLEAPYSWAGRLERMMHALTAHYRRHGHKISLVFDDDPDRGREDVERLLAPQYASVKRTGIDLTPI
LDENVEKLAPWVSRERCYLVCYTGRKALSAHELIDENRRIKQLIGQSPDARFGQNPVLAEMAGLKIRHDA
FMSAVEAAFKDDGQGVLLELLDAHAVGQALRSQVDRLGTSEHWYPLLPDDPITPHGVRNGDDHTPFLAPQ
LKFQLMNQDMETNGSKLCVNGMWHGTLSVVLGPQTPQTFAKLKALVPRGVPWRVRMDLMPGGMKSLGMKK
GTLDFMAFVPPLRPIWNSIETLTKVEQQEPVCVMTIMASTWGDSQAAVTRHLTLLTQAFQAWGVCEVTQT
FGNPVRAWASTLVASSKGSGPNLLYPPLSEALNLLPLTRPASAWEEDGNALFATLDGKLYPVGLATPKQN
KLTSVVTGSSGQGKSVLLNKLGNVTVSSAQQRLPFMAGVDKGFSMQGQVALLRDSLPPERKDEVVGIVLQ
NSPKHCRNLFDIQLGARFPIAPERNWIISMLTAMCIDPSTGNPPNERDTRQILDRVISMAYTANAEKSPR
AWARGVVPEVDTALDKSGLIERYPAQWWDSSTWYEVRDLLFEAGFVKEAQLAQFEAVPELADMTTFLNHE
DVESAYGRVQRDGSQELLLEYLHRCMTDACREFKMLAGRTQFLISPRTRVIAIDLNNVMGDNTTNAGHLK
TGIMFLFAGQVAGGDFVLPQYRDELLEAVPTLYHPMHLDRLEQLDQEVKTKVYDELHNAKQVPFIFPMLE
TQDREQRKFGIRTVLSSQYVSDFPDAILNSANSLYMMEVDPKDEKLLTDTIKVPKVTLQRFQRLGSGPAA
DGSGVPFLGVFRIKGGGTLARILKNAMGPLELWALGSSPTDSALRRLLYEAVGGSTARAILAEAFPQGTA
EKLIALRQKQAGEVDSNNVIRTLANELIKRRGYNL
 
Nucleotide Sequence: 3048 bp     [Download]
>gi|29171478|ref|NC_004633.1|:58596-61643 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000A, complete sequence
TTGATCCGTTGGGTTGAAGACCTGATCACAGAAACCTCCCGGTTTGCCGTATCACGCGATCTGCCCGACT
ATTGCGACTTGAACACGGTACTGCGTCTGACGGACGACGATCGCACTCGCCACCCAGCCCTCAATGCCCC
GTATGTACTGGTCAACGACGATGGCGATTACTGCTCGGTGTATGCCGTTGCCGGCAGTTTTTGTGACACC
GACGAAGCGGCACCCCTGGAGGCCCCTTATTCCTGGGCCGGCCGCTTGGAGCGCATGATGCATGCGCTGA
CAGCCCACTATCGCCGACATGGGCACAAAATCAGCCTGGTGTTCGACGATGACCCTGATCGAGGCCGCGA
GGACGTCGAACGCCTGCTGGCCCCTCAGTACGCTTCTGTCAAACGGACCGGCATCGACTTGACGCCGATC
CTGGACGAAAACGTTGAAAAGCTGGCCCCCTGGGTCTCTCGCGAACGCTGCTACCTGGTGTGTTACACCG
GACGCAAGGCGCTCTCTGCGCATGAACTGATCGACGAAAATCGCCGTATCAAGCAATTGATCGGGCAAAG
CCCGGATGCACGGTTTGGACAAAATCCGGTCCTGGCTGAAATGGCCGGCCTGAAAATTCGCCACGACGCC
TTCATGAGCGCTGTGGAAGCTGCCTTTAAAGATGATGGCCAGGGTGTGCTGCTGGAACTGCTCGATGCCC
ATGCAGTGGGCCAGGCGCTGCGCTCTCAAGTGGACCGGCTCGGTACCAGTGAGCATTGGTACCCGCTGCT
CCCTGATGATCCGATCACCCCGCATGGTGTGCGTAACGGCGACGATCACACACCGTTTCTGGCCCCGCAG
CTGAAATTCCAGCTGATGAACCAGGACATGGAAACCAACGGCAGCAAGCTCTGCGTCAATGGGATGTGGC
ATGGCACCTTGTCTGTCGTCCTGGGACCGCAGACGCCGCAGACCTTTGCCAAGCTCAAGGCGCTGGTCCC
TCGCGGCGTGCCTTGGCGCGTACGCATGGACCTGATGCCTGGGGGCATGAAGTCGCTAGGCATGAAAAAA
GGCACGTTGGACTTCATGGCGTTTGTGCCGCCGCTTCGGCCCATCTGGAACTCCATCGAAACGTTGACAA
AGGTTGAGCAACAAGAGCCGGTATGCGTCATGACGATCATGGCCTCCACCTGGGGTGACAGCCAGGCCGC
AGTGACGCGCCATCTGACGCTGCTGACCCAGGCCTTTCAGGCATGGGGAGTGTGCGAGGTGACGCAAACC
TTCGGCAACCCGGTACGCGCATGGGCCTCGACGCTGGTGGCTTCCAGCAAAGGCAGTGGCCCGAACCTGT
TGTATCCGCCGCTTTCAGAGGCGCTGAACCTGTTGCCGCTGACCCGCCCGGCCTCGGCTTGGGAGGAAGA
CGGCAACGCCTTGTTCGCTACGCTCGATGGCAAGCTCTATCCGGTCGGTCTGGCCACCCCCAAGCAGAAC
AAGCTCACCAGTGTGGTCACCGGCTCTTCCGGCCAGGGCAAGTCGGTGCTGCTGAACAAGCTGGGCAATG
TCACGGTGTCCAGCGCCCAGCAGCGATTACCGTTCATGGCGGGGGTGGACAAAGGTTTCTCGATGCAAGG
TCAAGTCGCCTTGCTGCGCGACAGTCTGCCGCCGGAGCGCAAGGACGAGGTCGTGGGCATTGTGCTGCAG
AACAGCCCCAAGCATTGCCGGAACCTGTTCGATATCCAGCTGGGCGCGCGGTTTCCGATCGCCCCCGAGC
GTAACTGGATCATCAGCATGCTCACGGCCATGTGCATTGACCCCTCTACCGGCAATCCGCCAAACGAACG
CGATACCCGGCAGATACTGGACCGCGTCATCAGCATGGCCTATACCGCCAATGCCGAAAAAAGCCCCAGA
GCCTGGGCGCGCGGGGTCGTCCCCGAAGTGGACACTGCCTTGGATAAAAGCGGGTTGATCGAGCGCTATC
CGGCCCAGTGGTGGGATAGCAGTACCTGGTATGAGGTGCGCGATCTGTTGTTTGAAGCAGGCTTTGTTAA
GGAAGCGCAGCTGGCCCAGTTCGAAGCAGTGCCGGAACTGGCCGACATGACCACCTTCCTGAACCATGAA
GACGTAGAAAGCGCCTATGGTCGGGTGCAACGTGATGGCAGTCAGGAGCTGTTGCTGGAGTACTTGCACC
GCTGCATGACTGACGCCTGTAGAGAATTCAAGATGCTGGCCGGGCGTACGCAGTTCTTGATCAGTCCACG
CACGCGAGTGATCGCGATCGATCTGAACAATGTCATGGGTGATAACACCACCAATGCTGGCCACCTGAAA
ACCGGAATCATGTTCCTGTTTGCGGGCCAGGTGGCTGGGGGCGATTTTGTGTTGCCTCAGTACAGGGATG
AGCTGTTGGAGGCGGTGCCCACGCTTTACCACCCCATGCATCTCGACCGCTTGGAGCAACTGGATCAGGA
GGTCAAAACCAAGGTCTACGACGAGCTGCACAATGCGAAACAGGTGCCCTTCATCTTTCCCATGCTGGAA
ACCCAGGATCGTGAGCAACGCAAATTCGGCATACGCACGGTGTTGTCCTCGCAGTACGTGAGCGACTTTC
CCGACGCCATTCTGAATTCGGCCAACTCGCTGTACATGATGGAGGTGGACCCCAAGGACGAGAAGCTTCT
GACCGACACCATCAAAGTGCCCAAGGTCACTCTGCAGCGCTTTCAGCGTTTAGGCTCAGGTCCAGCAGCG
GATGGCAGCGGCGTACCGTTTTTGGGCGTGTTCCGAATCAAGGGTGGCGGCACCCTGGCGCGCATTCTGA
AAAACGCCATGGGGCCCCTGGAACTATGGGCGTTGGGCTCTTCACCGACCGACAGCGCCCTGCGCAGGTT
GTTGTATGAAGCGGTCGGCGGTTCCACGGCTCGCGCCATCCTGGCCGAAGCCTTTCCCCAGGGCACGGCA
GAAAAACTCATCGCGCTGCGCCAGAAGCAAGCCGGTGAAGTGGATTCCAACAACGTGATTCGCACGCTGG
CCAACGAGTTGATCAAACGGCGTGGTTACAACCTCTAG
 Primer design