SecReT4
Protein ID: 29171590
T4SS name [ID]Tra_I [177]
Gene symbol-
Locus tagPSPTO_B0050
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]38589..39062 [+]
ProducttraH protein, putative
Component typeTraH_I
UniProt IDQ877L2
KEGG IDpst:PSPTOA0043, pst:PSPTO_B0050
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 157 a.a.     [Download]
>gi|29171590|ref|NP_808636.1| traH protein, putative [Pseudomonas syringae pv. tomato str. DC3000]
MKYSLWAAPAAALLLSGCQSFCEKPPAAPTPSATAAPVLDRVALQQETLWMEGAINTRSTLPTDAIRARS
DLVAVDWSGDAIELLSHLARQRGQTFAWTGVRLPLPVNLKVNGISYANLLRLIEMQTAWRATLTQLPGQL
TLAFAQAEPTKKAGGRQ
 
Nucleotide Sequence: 474 bp     [Download]
>gi|29171546|ref|NC_004632.1|:38589-39062 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGAAATACTCCCTTTGGGCTGCGCCGGCGGCGGCATTGCTGCTGTCTGGCTGCCAGAGTTTTTGTGAGA
AGCCGCCGGCGGCTCCTACGCCTTCTGCGACAGCTGCGCCGGTACTTGATCGGGTTGCGTTACAGCAAGA
AACGCTGTGGATGGAAGGTGCGATAAATACCCGGTCAACCCTGCCGACCGATGCTATCCGTGCTCGGAGC
GACCTGGTCGCGGTTGACTGGAGCGGTGACGCGATTGAGCTGCTGTCCCATCTGGCCCGCCAGCGCGGTC
AGACGTTTGCCTGGACCGGCGTGCGCCTGCCCTTGCCGGTGAACCTCAAGGTCAATGGAATCTCCTATGC
GAATCTGTTGCGTCTGATCGAGATGCAAACAGCCTGGCGTGCGACCCTGACCCAGCTTCCAGGGCAACTG
ACCCTGGCCTTTGCGCAGGCGGAGCCTACCAAGAAGGCGGGAGGGCGTCAGTGA
 Primer design