SecReT4
Protein ID: 29171591
T4SS name [ID]Tra_I [177]
Gene symbol-
Locus tagPSPTO_B0051
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]39059..39859 [+]
ProducttraI protein
Component typeTraI_I
UniProt IDQ877M5
KEGG IDpst:PSPTOA0044, pst:PSPTO_B0051
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 266 a.a.     [Download]
>gi|29171591|ref|NP_808637.1| traI protein [Pseudomonas syringae pv. tomato str. DC3000]
MKKSILTLVLLQGLQGCGHTPPSTPADTPAPLESYLVPADPPSADVTESRRQLLEESGRNTGFRGGKAER
VWELRQALEGQIGRLNTLYDFRTLISREGWLPPVIDEAVDVAHITPRQIRTASHVYEIIVPERFVSNPPS
WRTWLMAGLSSSGPDETVAVTPENRLQKALWQAAVRQGWGEGRQSADQTLEANFNRLTRDYRGMLMYSQL
LRQGFITAPVVTDQQQTVTGDRQKLTTGDRVRSLKENAGFVPDKTQWHPVIRKVQP
 
Nucleotide Sequence: 801 bp     [Download]
>gi|29171546|ref|NC_004632.1|:39059-39859 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
GTGAAAAAATCAATTCTGACGCTTGTCCTGTTGCAGGGCCTGCAAGGGTGTGGACATACGCCACCTTCCA
CACCCGCCGACACGCCGGCGCCACTGGAAAGCTATCTTGTCCCCGCTGACCCGCCGTCAGCAGACGTGAC
CGAATCGCGGCGACAACTGCTGGAGGAATCGGGACGCAATACAGGGTTTCGTGGCGGTAAGGCTGAGCGC
GTGTGGGAATTACGCCAGGCATTGGAGGGGCAGATCGGACGGCTCAACACCTTGTATGACTTTCGGACCC
TGATCAGCCGTGAGGGCTGGCTACCGCCAGTCATCGACGAGGCGGTGGACGTGGCCCATATCACGCCACG
GCAGATACGCACTGCAAGCCATGTTTACGAAATCATTGTGCCCGAACGGTTCGTCAGTAACCCACCGTCG
TGGCGTACCTGGTTGATGGCGGGCCTGTCATCGTCGGGCCCTGATGAAACCGTGGCAGTCACACCTGAAA
ACCGTTTGCAGAAGGCGCTTTGGCAAGCGGCGGTCCGCCAGGGCTGGGGTGAAGGGCGGCAAAGTGCCGA
TCAGACCCTTGAAGCCAATTTCAACCGCCTGACCCGAGATTACCGGGGCATGCTGATGTACTCGCAGTTA
CTGCGCCAGGGGTTCATCACGGCGCCGGTAGTCACGGATCAACAGCAGACCGTGACGGGGGATCGGCAGA
AGCTGACCACCGGCGATCGCGTACGAAGCCTCAAGGAGAACGCCGGCTTTGTTCCCGACAAAACTCAGTG
GCATCCGGTGATACGCAAGGTGCAGCCATGA
 Primer design