SecReT4
Protein ID: 29171592
T4SS name [ID]Tra_I [177]
Gene symbol-
Locus tagPSPTO_B0052
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]39856..41037 [+]
Producttype IV pilus biogenesis protein
Component typeTraJ_I
UniProt IDQ88BT1
KEGG IDpst:PSPTO_B0052
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2e-28, Aligned region: 31..312
Protein Sequence: 393 a.a.     [Download]
>gi|29171592|ref|NP_808638.1| type IV pilus biogenesis protein [Pseudomonas syringae pv. tomato str. DC3000]
MTQTAQTMEFAPYAFEDGLNADTLRDFFVWCERQSASDIHIQGGNHLVVGHQGRLRQASRFVLADDTWSK
LLDDLFSPEIRPTVRGGRPVDRAIQLDGDINQRYGLERGERLRFRCNFVQATAGRLDTTIALTMRIIPSD
IPDLTKMGLEEDLFEALLPSNGLGLIGGITGSGKSTQAAAIYRFCLDTDPDRKVTTIEDPIEFILARPGD
VLASTQLQIGRDVANYAEGIRADLRRAPSIIGVGEMRDLETFQAAVLAGQVGHFNLSTLHIHSPGEAIPR
CLTMVPSEMREATAHDLLSVLQYIIVQKLLRTTDGKRQAVREYIIFDDGLRAKLASMPYPEWGRHIDSII
RLEQRRFADQAWRLHLEGRIDRRELAVAMTASQLRELEQRATP
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|29171546|ref|NC_004632.1|:39856-41037 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGACCCAGACGGCCCAGACAATGGAGTTTGCCCCCTACGCTTTTGAAGACGGGCTGAATGCAGACACCT
TGCGCGATTTTTTCGTCTGGTGTGAACGGCAGTCAGCCAGCGACATTCACATCCAGGGCGGTAACCACCT
GGTGGTAGGGCATCAAGGTCGCTTGCGCCAGGCCAGCCGGTTTGTGCTGGCTGACGATACGTGGTCCAAG
CTCCTCGATGATCTGTTCAGCCCTGAAATCCGGCCGACGGTACGCGGTGGTCGGCCTGTAGACCGGGCCA
TACAGCTGGATGGCGACATCAACCAGCGCTACGGCCTGGAGCGTGGCGAGCGATTACGCTTTCGCTGCAA
CTTTGTGCAGGCCACTGCTGGGCGACTGGACACCACCATCGCACTGACGATGCGGATCATTCCATCTGAT
ATCCCGGATCTAACAAAGATGGGGCTGGAAGAGGATCTGTTCGAAGCGTTGTTGCCGTCCAATGGTCTAG
GACTCATTGGTGGAATCACGGGGTCGGGTAAAAGTACCCAGGCGGCCGCTATCTACCGCTTTTGCCTGGA
CACCGATCCTGACCGCAAGGTGACCACGATCGAAGACCCGATCGAATTCATTCTCGCGCGTCCAGGGGAT
GTATTGGCCTCGACGCAACTGCAGATAGGTCGAGACGTTGCCAACTATGCCGAAGGCATTCGGGCAGATC
TTCGCCGGGCACCGTCGATCATCGGGGTGGGTGAAATGCGGGATTTGGAAACCTTCCAGGCGGCCGTTTT
GGCCGGACAGGTGGGCCATTTCAATCTCAGCACCTTGCACATCCATTCGCCTGGAGAGGCCATTCCACGG
TGCCTGACCATGGTGCCCTCGGAAATGCGCGAGGCTACGGCCCACGATCTACTGAGCGTTCTGCAATACA
TCATCGTGCAAAAGCTGCTGCGCACCACCGATGGCAAGCGCCAGGCCGTGCGCGAATACATCATCTTCGA
TGATGGGCTGCGCGCCAAGCTGGCCAGCATGCCTTATCCCGAATGGGGTCGGCATATCGACTCCATTATT
CGCCTGGAGCAACGACGCTTCGCTGATCAGGCCTGGCGTCTTCATCTGGAAGGGCGCATTGACCGGCGTG
AACTGGCGGTGGCCATGACCGCCTCTCAATTGCGAGAACTCGAACAGCGGGCCACGCCATGA
 Primer design