SecReT4
Protein ID: 29171596
T4SS name [ID]Tra_I [177]
Gene symboltraK-1
Locus tagPSPTO_B0056
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]42592..42879 [+]
ProducttraK protein
Component typeTraK_I
UniProt IDQ88BS7
KEGG IDpst:PSPTO_B0056
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 95 a.a.     [Download]
>gi|29171596|ref|NP_808642.1| traK protein [Pseudomonas syringae pv. tomato str. DC3000]
MSDQQLQPGYWRNASRLLNLYGIPAPLFLLYLAWFRFPSMVTIYVITAIIGGFRLLSFFGWTFKVLVMRL
AYLLRGKRLSGRPWWYRRFTERGER
 
Nucleotide Sequence: 288 bp     [Download]
>gi|29171546|ref|NC_004632.1|:42592-42879 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGTCTGACCAGCAACTGCAACCGGGCTATTGGCGCAATGCCTCACGCCTTCTCAATCTCTACGGCATAC
CAGCCCCCTTGTTCTTGTTGTACCTGGCGTGGTTTCGCTTCCCCTCCATGGTCACGATCTACGTCATCAC
CGCCATTATTGGCGGCTTTCGGCTGCTCTCGTTCTTTGGGTGGACGTTCAAGGTCCTGGTGATGCGACTG
GCTTACCTGTTGCGCGGCAAGCGCTTGTCCGGTCGGCCCTGGTGGTATCGACGCTTTACCGAAAGGGGGG
AGCGATGA
 Primer design