SecReT4
Protein ID: 29171598
T4SS name [ID]Tra_I [177]
Gene symboltraL-1
Locus tagPSPTO_B0058
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]47621..47974 [+]
ProducttraL protein
Component typeTraL_I
UniProt IDQ877T0
KEGG IDpst:PSPTOA0050, pst:PSPTO_B0058
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 117 a.a.     [Download]
>gi|29171598|ref|NP_808644.1| traL protein [Pseudomonas syringae pv. tomato str. DC3000]
MKKSMCGALLMVVCCLPVVGNAAVCRSGQAASVGSQTAYERAKKASDVWAERERTVSDELQDCLSRIRTT
SISLPSFPSLEDLMNQVADQVCQAAVDKINSHIPSGSDPWQSVGGSL
 
Nucleotide Sequence: 354 bp     [Download]
>gi|29171546|ref|NC_004632.1|:47621-47974 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGAAGAAAAGCATGTGCGGTGCACTGCTGATGGTTGTGTGCTGCCTGCCCGTTGTGGGAAACGCAGCAG
TGTGCCGCTCAGGACAAGCGGCCAGTGTGGGCAGTCAGACTGCGTATGAGCGGGCCAAGAAGGCGTCGGA
CGTGTGGGCAGAGCGCGAGCGCACCGTCTCAGACGAACTCCAGGATTGCTTGTCGCGCATTCGCACCACC
AGCATCAGCCTTCCCTCGTTTCCAAGCCTGGAAGACCTGATGAACCAGGTGGCCGATCAGGTATGCCAGG
CGGCGGTGGACAAGATCAACAGCCATATCCCCAGCGGCTCGGACCCTTGGCAGTCGGTAGGAGGTTCATT
GTGA
 Primer design