SecReT4
Protein ID: 29171599
T4SS name [ID]Tra_I [177]
Gene symboltraM-1
Locus tagPSPTO_B0059
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]48001..48678 [+]
ProducttraM protein
Component typeTraM_I
UniProt IDQ88BS5
KEGG IDpst:PSPTO_B0059
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 7.9e-33, Aligned region: 77..182
Protein Sequence: 225 a.a.     [Download]
>gi|29171599|ref|NP_808645.1| traM protein [Pseudomonas syringae pv. tomato str. DC3000]
MEESLEIPHLPTAEDQHTFEHAMQLQRDRALGAAFAHRCLTAVLWMAPALVLSVSVNGYLGWQVAHPPVK
YFAAEGGRVTKIIPTDKPGHSRRDVSAFGADTIRQSFTLDFVHYRDQMTQLGERYSEVGFQDYYKALVAS
NLLKAVKDQRMNLWVDVGPGVIRGSGTIGDKFAWEYQYPVTLKLDGQQSGSPPQRFIFTLRIQQTDVRVK
NAGLEVTQVITTNAN
 
Nucleotide Sequence: 678 bp     [Download]
>gi|29171546|ref|NC_004632.1|:48001-48678 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
GTGGAAGAGTCTCTGGAAATACCTCACCTCCCCACGGCGGAAGATCAGCACACGTTCGAGCATGCCATGC
AGTTGCAGCGTGACCGTGCGTTAGGTGCGGCATTCGCCCATCGCTGTCTGACCGCAGTGCTCTGGATGGC
ACCTGCACTGGTGCTATCGGTCAGCGTGAATGGCTACTTGGGCTGGCAGGTCGCTCATCCTCCGGTGAAG
TACTTCGCGGCCGAGGGTGGTCGCGTGACCAAGATCATCCCTACGGACAAACCAGGGCATAGCAGGCGTG
ACGTGTCGGCCTTTGGGGCCGACACCATTCGCCAGAGCTTCACTCTGGACTTCGTGCATTACCGCGATCA
GATGACCCAACTGGGCGAACGCTACTCGGAAGTGGGCTTCCAGGACTATTACAAAGCCTTGGTGGCCTCG
AACCTGCTCAAAGCGGTCAAGGATCAGCGCATGAACCTCTGGGTAGACGTTGGCCCAGGTGTGATTCGCG
GTAGCGGGACGATCGGGGACAAGTTTGCCTGGGAGTACCAGTACCCGGTGACTTTGAAGCTGGATGGTCA
GCAATCGGGCAGTCCGCCTCAGCGCTTCATTTTTACTCTGCGCATTCAGCAGACGGACGTACGCGTGAAA
AACGCAGGATTGGAAGTCACGCAAGTGATTACCACCAACGCTAACTGA
 Primer design