SecReT4
Protein ID: 29171600
T4SS name [ID]Tra_I [177]
Gene symboltraN-1
Locus tagPSPTO_B0060
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]48735..49793 [+]
ProducttraN protein
Component typeTraN_I
UniProt IDQ877T8
KEGG IDpst:PSPTOA0052, pst:PSPTO_B0060
PDB IDNA
Domain hit(s) vs Pfam DUF3625 [PF12293], Evalue: 8.3e-96, Aligned region: 105..350
Protein Sequence: 352 a.a.     [Download]
>gi|29171600|ref|NP_808646.1| traN protein [Pseudomonas syringae pv. tomato str. DC3000]
MKTSIALALWLAASGYAWADETVSPEAAPAKSAVPPSAPVTPAAGAAPSGWATGVGVNPAAQKAGSPAQG
NGPVNAAPAQQPSGNDPLPPPPSELFQKAQDSVSPLTPQEIRQLRGQVGEVDKAMAAPQVAIVPRISAQT
VNLSPGASLPLVRTAVNYPTSLTFIDSTGAPWNLGAAPISGNPDITPYYVPNSPVMVLYAAKPFASGNVT
VYLKGLAVPIMLYVSSGESDTKAQTWAVDARLDLRVPRRGPGAQPGAAPEVRIGLHDRVLQGFLDGVPPK
EAKQLKTTGNVPDTTVWQMGDDLYIRTRADIRDEFESTLSSADGTHLWKLPVTPYVSFSVMGHTAALNVA
LE
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|29171546|ref|NC_004632.1|:48735-49793 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGAAAACTTCAATTGCGCTGGCCCTATGGCTAGCGGCAAGCGGCTACGCCTGGGCGGATGAAACTGTCA
GCCCAGAGGCCGCTCCGGCTAAATCTGCGGTTCCCCCCTCTGCCCCTGTTACGCCTGCTGCGGGGGCTGC
ACCTTCGGGCTGGGCTACGGGCGTGGGTGTAAACCCAGCAGCACAGAAAGCCGGATCGCCGGCACAAGGT
AATGGCCCTGTGAATGCAGCACCAGCTCAGCAACCGTCTGGAAATGATCCGCTCCCTCCGCCGCCATCCG
AGCTTTTTCAAAAGGCTCAGGACAGCGTTTCTCCGCTGACTCCCCAAGAGATTCGGCAACTGCGCGGGCA
GGTTGGAGAGGTTGACAAGGCCATGGCCGCACCGCAGGTCGCCATTGTGCCGAGAATCAGCGCACAAACG
GTGAATCTGTCGCCGGGGGCCAGTTTGCCGCTGGTGCGCACGGCGGTGAACTACCCCACTTCCTTGACCT
TTATCGACAGTACCGGCGCGCCGTGGAACCTGGGCGCCGCGCCCATCAGTGGCAACCCCGATATCACGCC
GTATTACGTGCCCAATAGCCCGGTCATGGTCTTGTACGCCGCAAAGCCTTTTGCCAGCGGAAACGTCACG
GTTTACCTGAAAGGTTTGGCCGTGCCGATCATGCTCTACGTCAGCAGCGGGGAGTCGGATACCAAGGCCC
AGACGTGGGCAGTGGACGCTCGCCTGGACTTGCGTGTGCCCAGGCGTGGGCCAGGTGCTCAGCCAGGCGC
CGCTCCCGAGGTCCGTATCGGCTTGCACGATCGGGTGCTGCAGGGGTTTCTCGATGGCGTTCCACCCAAG
GAGGCCAAACAGCTCAAAACCACCGGCAACGTGCCAGACACCACGGTGTGGCAAATGGGTGACGATCTGT
ACATCCGCACGCGGGCTGATATCCGGGACGAGTTCGAATCCACGTTGTCGTCGGCAGACGGTACGCATCT
CTGGAAATTACCCGTGACGCCCTATGTGTCGTTCTCAGTCATGGGCCACACAGCGGCCCTCAACGTCGCC
TTGGAGTAA
 Primer design